BLASTX nr result
ID: Panax25_contig00016261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00016261 (592 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019067503.1 PREDICTED: starch synthase IV isoform X1 [Solanum... 88 7e-17 NP_001234617.2 starch synthase IV [Solanum lycopersicum] 88 7e-17 ACT09058.1 starch synthase IV precursor [Solanum lycopersicum] 88 7e-17 XP_016451587.1 PREDICTED: probable starch synthase 4, chloroplas... 87 2e-16 XP_016556252.1 PREDICTED: probable starch synthase 4, chloroplas... 87 2e-16 XP_015065067.1 PREDICTED: probable starch synthase 4, chloroplas... 87 3e-16 XP_009775646.1 PREDICTED: probable starch synthase 4, chloroplas... 87 3e-16 XP_016487827.1 PREDICTED: probable starch synthase 4, chloroplas... 87 3e-16 AKQ62851.1 starch synthase [Camellia sinensis] 86 6e-16 OIT39343.1 putative starch synthase 4, chloroplasticamyloplastic... 85 9e-16 XP_019260204.1 PREDICTED: probable starch synthase 4, chloroplas... 85 9e-16 XP_017223019.1 PREDICTED: probable starch synthase 4, chloroplas... 85 9e-16 KZM84625.1 hypothetical protein DCAR_027953 [Daucus carota subsp... 85 9e-16 XP_012848494.1 PREDICTED: probable starch synthase 4, chloroplas... 84 3e-15 XP_019189287.1 PREDICTED: probable starch synthase 4, chloroplas... 84 3e-15 XP_019189286.1 PREDICTED: probable starch synthase 4, chloroplas... 84 3e-15 XP_017406016.1 PREDICTED: probable starch synthase 4, chloroplas... 83 4e-15 XP_017406014.1 PREDICTED: probable starch synthase 4, chloroplas... 83 4e-15 BAT74114.1 hypothetical protein VIGAN_01171300 [Vigna angularis ... 83 4e-15 XP_015382442.1 PREDICTED: probable starch synthase 4, chloroplas... 83 5e-15 >XP_019067503.1 PREDICTED: starch synthase IV isoform X1 [Solanum lycopersicum] XP_019067504.1 PREDICTED: starch synthase IV isoform X1 [Solanum lycopersicum] Length = 864 Score = 88.2 bits (217), Expect = 7e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HA+YRT ELGGQFVLLGSSPVP+IQREFEDIANHFQ+HEHARL+ K Sbjct: 686 HAVYRTLELGGQFVLLGSSPVPHIQREFEDIANHFQNHEHARLVLK 731 >NP_001234617.2 starch synthase IV [Solanum lycopersicum] Length = 1001 Score = 88.2 bits (217), Expect = 7e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HA+YRT ELGGQFVLLGSSPVP+IQREFEDIANHFQ+HEHARL+ K Sbjct: 823 HAVYRTLELGGQFVLLGSSPVPHIQREFEDIANHFQNHEHARLVLK 868 >ACT09058.1 starch synthase IV precursor [Solanum lycopersicum] Length = 1001 Score = 88.2 bits (217), Expect = 7e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HA+YRT ELGGQFVLLGSSPVP+IQREFEDIANHFQ+HEHARL+ K Sbjct: 823 HAVYRTLELGGQFVLLGSSPVPHIQREFEDIANHFQNHEHARLVLK 868 >XP_016451587.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic, partial [Nicotiana tabacum] Length = 457 Score = 86.7 bits (213), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP+IQREFEDI NHFQ+HEHARL+ K Sbjct: 279 HAIYRTLELGGQFVLLGSSPVPHIQREFEDIRNHFQNHEHARLVLK 324 >XP_016556252.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic [Capsicum annuum] Length = 1006 Score = 87.0 bits (214), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP+IQREFEDI NHFQ+HEHARL+ K Sbjct: 828 HAIYRTLELGGQFVLLGSSPVPHIQREFEDIGNHFQNHEHARLVLK 873 >XP_015065067.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic [Solanum pennellii] Length = 1001 Score = 86.7 bits (213), Expect = 3e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HA+YRT ELGGQFVLLGSSPVP+IQREFEDI NHFQ+HEHARL+ K Sbjct: 823 HAVYRTLELGGQFVLLGSSPVPHIQREFEDIGNHFQNHEHARLVLK 868 >XP_009775646.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic [Nicotiana sylvestris] Length = 1002 Score = 86.7 bits (213), Expect = 3e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP+IQREFEDI NHFQ+HEHARL+ K Sbjct: 824 HAIYRTLELGGQFVLLGSSPVPHIQREFEDIRNHFQNHEHARLVLK 869 >XP_016487827.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic [Nicotiana tabacum] Length = 1008 Score = 86.7 bits (213), Expect = 3e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP+IQREFEDI NHFQ+HEHARL+ K Sbjct: 830 HAIYRTLELGGQFVLLGSSPVPHIQREFEDIRNHFQNHEHARLVLK 875 >AKQ62851.1 starch synthase [Camellia sinensis] Length = 1014 Score = 85.5 bits (210), Expect = 6e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP+IQREFE+IANHFQSH+H RLI K Sbjct: 835 HAIYRTMELGGQFVLLGSSPVPHIQREFEEIANHFQSHKHVRLILK 880 >OIT39343.1 putative starch synthase 4, chloroplasticamyloplastic [Nicotiana attenuata] Length = 951 Score = 85.1 bits (209), Expect = 9e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP+IQREFEDI NHF++HEHARL+ K Sbjct: 773 HAIYRTLELGGQFVLLGSSPVPHIQREFEDIRNHFRTHEHARLVLK 818 >XP_019260204.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic [Nicotiana attenuata] Length = 996 Score = 85.1 bits (209), Expect = 9e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP+IQREFEDI NHF++HEHARL+ K Sbjct: 818 HAIYRTLELGGQFVLLGSSPVPHIQREFEDIRNHFRTHEHARLVLK 863 >XP_017223019.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic [Daucus carota subsp. sativus] Length = 1042 Score = 85.1 bits (209), Expect = 9e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP+IQ+EFE+IANHFQSHEH RL+ K Sbjct: 864 HAIYRTLELGGQFVLLGSSPVPHIQKEFEEIANHFQSHEHVRLLLK 909 >KZM84625.1 hypothetical protein DCAR_027953 [Daucus carota subsp. sativus] Length = 1102 Score = 85.1 bits (209), Expect = 9e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP+IQ+EFE+IANHFQSHEH RL+ K Sbjct: 924 HAIYRTLELGGQFVLLGSSPVPHIQKEFEEIANHFQSHEHVRLLLK 969 >XP_012848494.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic [Erythranthe guttata] Length = 1028 Score = 83.6 bits (205), Expect = 3e-15 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSPVP IQREFEDI NHF++HEHARL+ K Sbjct: 850 HAIYRTLELGGQFVLLGSSPVPQIQREFEDIENHFRTHEHARLLLK 895 >XP_019189287.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic isoform X2 [Ipomoea nil] Length = 1107 Score = 83.6 bits (205), Expect = 3e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSP+ +IQREFEDI+NHFQ+HEHARLI K Sbjct: 928 HAIYRTLELGGQFVLLGSSPLSHIQREFEDISNHFQNHEHARLILK 973 >XP_019189286.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic isoform X1 [Ipomoea nil] Length = 1130 Score = 83.6 bits (205), Expect = 3e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQFVLLGSSP+ +IQREFEDI+NHFQ+HEHARLI K Sbjct: 951 HAIYRTLELGGQFVLLGSSPLSHIQREFEDISNHFQNHEHARLILK 996 >XP_017406016.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic isoform X2 [Vigna angularis] KOM25917.1 hypothetical protein LR48_Vigan205s005400 [Vigna angularis] Length = 997 Score = 83.2 bits (204), Expect = 4e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT+ELGGQFVLLGSSPVP+IQ+EFE IANHFQ+H+H RLI K Sbjct: 819 HAIYRTSELGGQFVLLGSSPVPHIQKEFEGIANHFQNHDHVRLILK 864 >XP_017406014.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic isoform X1 [Vigna angularis] XP_017406015.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic isoform X1 [Vigna angularis] Length = 998 Score = 83.2 bits (204), Expect = 4e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT+ELGGQFVLLGSSPVP+IQ+EFE IANHFQ+H+H RLI K Sbjct: 820 HAIYRTSELGGQFVLLGSSPVPHIQKEFEGIANHFQNHDHVRLILK 865 >BAT74114.1 hypothetical protein VIGAN_01171300 [Vigna angularis var. angularis] Length = 998 Score = 83.2 bits (204), Expect = 4e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT+ELGGQFVLLGSSPVP+IQ+EFE IANHFQ+H+H RLI K Sbjct: 819 HAIYRTSELGGQFVLLGSSPVPHIQKEFEGIANHFQNHDHVRLILK 864 >XP_015382442.1 PREDICTED: probable starch synthase 4, chloroplastic/amyloplastic isoform X2 [Citrus sinensis] Length = 831 Score = 82.8 bits (203), Expect = 5e-15 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -2 Query: 444 HAIYRTAELGGQFVLLGSSPVPYIQREFEDIANHFQSHEHARLI*K 307 HAIYRT ELGGQF+LLGSSPVP+IQREFE IANHFQ+H+H RLI K Sbjct: 652 HAIYRTLELGGQFILLGSSPVPHIQREFEGIANHFQNHDHIRLILK 697