BLASTX nr result
ID: Panax25_contig00015856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015856 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ75741.1 hypothetical protein ZOSMA_10G00050 [Zostera marina] 66 1e-11 ACB38163.1 putative calcium dependent protein kinase, partial [A... 67 1e-11 ABO65098.1 calcium-dependent protein kinase 5, partial [Nicotian... 69 2e-11 ABO65103.1 calcium-dependent protein kinase 4, partial [Nicotian... 69 2e-11 CDP01899.1 unnamed protein product [Coffea canephora] 69 3e-11 XP_016508891.1 PREDICTED: calcium-dependent protein kinase 28-li... 69 3e-11 XP_016560509.1 PREDICTED: calcium-dependent protein kinase 28-li... 69 3e-11 XP_011097051.1 PREDICTED: calcium-dependent protein kinase 28-li... 69 3e-11 XP_015070510.1 PREDICTED: calcium-dependent protein kinase 28 is... 69 3e-11 NP_001234607.1 calcium-dependent protein kinase [Solanum lycoper... 69 3e-11 XP_019182771.1 PREDICTED: calcium-dependent protein kinase 28-li... 69 3e-11 NP_001312822.1 calcium-dependent protein kinase 28-like [Nicotia... 69 3e-11 XP_009590568.1 PREDICTED: calcium-dependent protein kinase 18-li... 69 3e-11 XP_019253137.1 PREDICTED: calcium-dependent protein kinase 18-li... 69 3e-11 OAY57544.1 hypothetical protein MANES_02G104800 [Manihot esculenta] 69 3e-11 XP_009764390.1 PREDICTED: calcium-dependent protein kinase 28-li... 69 3e-11 XP_006343369.1 PREDICTED: protein kinase CPK1 isoform X2 [Solanu... 69 3e-11 XP_016507827.1 PREDICTED: calcium-dependent protein kinase 28-li... 69 3e-11 XP_009759436.1 PREDICTED: calcium-dependent protein kinase 28-li... 69 3e-11 XP_019237665.1 PREDICTED: calcium-dependent protein kinase 28-li... 69 3e-11 >KMZ75741.1 hypothetical protein ZOSMA_10G00050 [Zostera marina] Length = 99 Score = 65.9 bits (159), Expect = 1e-11 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +2 Query: 227 RFITE*DFKKGTLLGKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 RF T+ +K KKF+DIVGSAYYVAPEVLKR+SGP+SDVWSI Sbjct: 3 RFTTDLVWKIPQFFKKKFRDIVGSAYYVAPEVLKRKSGPQSDVWSI 48 >ACB38163.1 putative calcium dependent protein kinase, partial [Agrostemma githago] Length = 148 Score = 67.0 bits (162), Expect = 1e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKF DIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 113 GKKFNDIVGSAYYVAPEVLKRRSGPESDVWSI 144 >ABO65098.1 calcium-dependent protein kinase 5, partial [Nicotiana attenuata] Length = 313 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 252 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 283 >ABO65103.1 calcium-dependent protein kinase 4, partial [Nicotiana attenuata] Length = 328 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 260 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 291 >CDP01899.1 unnamed protein product [Coffea canephora] Length = 527 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 219 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 250 >XP_016508891.1 PREDICTED: calcium-dependent protein kinase 28-like [Nicotiana tabacum] Length = 547 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 265 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 296 >XP_016560509.1 PREDICTED: calcium-dependent protein kinase 28-like [Capsicum annuum] Length = 556 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 251 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 282 >XP_011097051.1 PREDICTED: calcium-dependent protein kinase 28-like [Sesamum indicum] Length = 561 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 255 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 286 >XP_015070510.1 PREDICTED: calcium-dependent protein kinase 28 isoform X2 [Solanum pennellii] Length = 565 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 265 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 296 >NP_001234607.1 calcium-dependent protein kinase [Solanum lycopersicum] ACS74732.1 calcium-dependent protein kinase [Solanum lycopersicum] Length = 565 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 265 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 296 >XP_019182771.1 PREDICTED: calcium-dependent protein kinase 28-like [Ipomoea nil] Length = 567 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 262 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 293 >NP_001312822.1 calcium-dependent protein kinase 28-like [Nicotiana tabacum] AAX81331.1 calcium-dependent protein kinase [Nicotiana tabacum] Length = 567 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 264 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 295 >XP_009590568.1 PREDICTED: calcium-dependent protein kinase 18-like [Nicotiana tomentosiformis] Length = 567 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 264 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 295 >XP_019253137.1 PREDICTED: calcium-dependent protein kinase 18-like [Nicotiana attenuata] OIS98344.1 calcium-dependent protein kinase 16 [Nicotiana attenuata] Length = 568 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 265 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 296 >OAY57544.1 hypothetical protein MANES_02G104800 [Manihot esculenta] Length = 568 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 262 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 293 >XP_009764390.1 PREDICTED: calcium-dependent protein kinase 28-like [Nicotiana sylvestris] Length = 568 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 265 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 296 >XP_006343369.1 PREDICTED: protein kinase CPK1 isoform X2 [Solanum tuberosum] Length = 568 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 268 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 299 >XP_016507827.1 PREDICTED: calcium-dependent protein kinase 28-like isoform X2 [Nicotiana tabacum] Length = 570 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 265 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 296 >XP_009759436.1 PREDICTED: calcium-dependent protein kinase 28-like [Nicotiana sylvestris] Length = 570 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 265 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 296 >XP_019237665.1 PREDICTED: calcium-dependent protein kinase 28-like [Nicotiana attenuata] OIT22262.1 calcium-dependent protein kinase 16 [Nicotiana attenuata] Length = 572 Score = 68.9 bits (167), Expect = 3e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 269 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 364 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI Sbjct: 267 GKKFQDIVGSAYYVAPEVLKRRSGPESDVWSI 298