BLASTX nr result
ID: Panax25_contig00015683
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015683 (478 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014621208.1 PREDICTED: DUF21 domain-containing protein At4g14... 64 2e-12 JAU12975.1 DUF21 domain-containing protein, partial [Noccaea cae... 68 3e-11 EYU43839.1 hypothetical protein MIMGU_mgv1a006486mg [Erythranthe... 70 4e-11 XP_012858337.1 PREDICTED: DUF21 domain-containing protein At4g14... 70 4e-11 CBI26178.3 unnamed protein product, partial [Vitis vinifera] 70 4e-11 KZV20765.1 hypothetical protein F511_04123 [Dorcoceras hygrometr... 70 4e-11 XP_010103432.1 hypothetical protein L484_010034 [Morus notabilis... 70 4e-11 XP_011071536.1 PREDICTED: DUF21 domain-containing protein At4g14... 70 4e-11 XP_002280174.1 PREDICTED: DUF21 domain-containing protein At4g14... 70 4e-11 EPS74558.1 hypothetical protein M569_00197, partial [Genlisea au... 70 5e-11 XP_013630767.1 PREDICTED: DUF21 domain-containing protein At4g14... 70 5e-11 AAD02547.1 PGPS/D5, partial [Petunia x hybrida] 64 6e-11 KJB28284.1 hypothetical protein B456_005G040600 [Gossypium raimo... 69 7e-11 KJB72305.1 hypothetical protein B456_011G170300 [Gossypium raimo... 69 9e-11 NP_001328231.1 CBS domain protein with a domain protein (DUF21) ... 69 9e-11 KJB28287.1 hypothetical protein B456_005G040600 [Gossypium raimo... 69 9e-11 XP_011013038.1 PREDICTED: DUF21 domain-containing protein At4g14... 69 9e-11 KJB28289.1 hypothetical protein B456_005G040600 [Gossypium raimo... 69 9e-11 AQK93069.1 DUF21 domain-containing protein, partial [Zea mays] 69 1e-10 KDO74826.1 hypothetical protein CISIN_1g010325mg [Citrus sinensis] 69 1e-10 >XP_014621208.1 PREDICTED: DUF21 domain-containing protein At4g14240-like [Glycine max] XP_014621209.1 PREDICTED: DUF21 domain-containing protein At4g14240-like [Glycine max] XP_014621210.1 PREDICTED: DUF21 domain-containing protein At4g14240-like [Glycine max] XP_014621211.1 PREDICTED: DUF21 domain-containing protein At4g14240-like [Glycine max] XP_014621212.1 PREDICTED: DUF21 domain-containing protein At4g14240-like [Glycine max] XP_014621213.1 PREDICTED: DUF21 domain-containing protein At4g14240-like [Glycine max] KRH20916.1 hypothetical protein GLYMA_13G209200 [Glycine max] Length = 145 Score = 64.3 bits (155), Expect(2) = 2e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 + EVIG+ITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 73 EDEVIGVITLEDVFEELLQEEIVDETDEYVDVHK 106 Score = 35.0 bits (79), Expect(2) = 2e-12 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = +3 Query: 144 TCPINS*VNCPKGSWRPK*ARANSKQ 221 T IN ++CPKGSWR K ARAN K+ Sbjct: 108 TGSINPKIDCPKGSWRSKQARANWKK 133 >JAU12975.1 DUF21 domain-containing protein, partial [Noccaea caerulescens] Length = 175 Score = 67.8 bits (164), Expect = 3e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIG+ITLEDVFEE+LQEEIVDETDE+VDVHK Sbjct: 86 DGEVIGVITLEDVFEEILQEEIVDETDEYVDVHK 119 >EYU43839.1 hypothetical protein MIMGU_mgv1a006486mg [Erythranthe guttata] Length = 442 Score = 70.1 bits (170), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK Sbjct: 356 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 389 >XP_012858337.1 PREDICTED: DUF21 domain-containing protein At4g14240-like [Erythranthe guttata] Length = 466 Score = 70.1 bits (170), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK Sbjct: 380 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 413 >CBI26178.3 unnamed protein product, partial [Vitis vinifera] Length = 474 Score = 70.1 bits (170), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK Sbjct: 377 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 410 >KZV20765.1 hypothetical protein F511_04123 [Dorcoceras hygrometricum] Length = 488 Score = 70.1 bits (170), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK Sbjct: 403 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 436 >XP_010103432.1 hypothetical protein L484_010034 [Morus notabilis] EXB95835.1 hypothetical protein L484_010034 [Morus notabilis] Length = 500 Score = 70.1 bits (170), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK Sbjct: 402 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 435 >XP_011071536.1 PREDICTED: DUF21 domain-containing protein At4g14240-like [Sesamum indicum] Length = 503 Score = 70.1 bits (170), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK Sbjct: 406 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 439 >XP_002280174.1 PREDICTED: DUF21 domain-containing protein At4g14240 [Vitis vinifera] Length = 505 Score = 70.1 bits (170), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK Sbjct: 408 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 441 >EPS74558.1 hypothetical protein M569_00197, partial [Genlisea aurea] Length = 442 Score = 69.7 bits (169), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEV+GIITLEDVFEELLQEEIVDETDEFVDVHK Sbjct: 409 DGEVVGIITLEDVFEELLQEEIVDETDEFVDVHK 442 >XP_013630767.1 PREDICTED: DUF21 domain-containing protein At4g14230 [Brassica oleracea var. oleracea] XP_013736680.1 PREDICTED: DUF21 domain-containing protein At4g14230-like [Brassica napus] CDY65026.1 BnaC03g76080D [Brassica napus] Length = 471 Score = 69.7 bits (169), Expect = 5e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIG+ITLEDVFEELLQEEIVDETDEFVDVHK Sbjct: 387 DGEVIGVITLEDVFEELLQEEIVDETDEFVDVHK 420 >AAD02547.1 PGPS/D5, partial [Petunia x hybrida] Length = 65 Score = 64.3 bits (155), Expect = 6e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 7 EVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 EVIGIITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 2 EVIGIITLEDVFEELLQEEIVDETDEYVDVHK 33 >KJB28284.1 hypothetical protein B456_005G040600 [Gossypium raimondii] KJB28285.1 hypothetical protein B456_005G040600 [Gossypium raimondii] KJB28286.1 hypothetical protein B456_005G040600 [Gossypium raimondii] Length = 319 Score = 68.9 bits (167), Expect = 7e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 242 DGEVIGIITLEDVFEELLQEEIVDETDEYVDVHK 275 >KJB72305.1 hypothetical protein B456_011G170300 [Gossypium raimondii] Length = 373 Score = 68.9 bits (167), Expect = 9e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 299 DGEVIGIITLEDVFEELLQEEIVDETDEYVDVHK 332 >NP_001328231.1 CBS domain protein with a domain protein (DUF21) [Arabidopsis thaliana] ANM66327.1 CBS domain protein with a domain protein (DUF21) [Arabidopsis thaliana] Length = 390 Score = 68.9 bits (167), Expect = 9e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 297 DGEVIGIITLEDVFEELLQEEIVDETDEYVDVHK 330 >KJB28287.1 hypothetical protein B456_005G040600 [Gossypium raimondii] Length = 390 Score = 68.9 bits (167), Expect = 9e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 313 DGEVIGIITLEDVFEELLQEEIVDETDEYVDVHK 346 >XP_011013038.1 PREDICTED: DUF21 domain-containing protein At4g14240-like isoform X3 [Populus euphratica] Length = 401 Score = 68.9 bits (167), Expect = 9e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 306 DGEVIGIITLEDVFEELLQEEIVDETDEYVDVHK 339 >KJB28289.1 hypothetical protein B456_005G040600 [Gossypium raimondii] Length = 405 Score = 68.9 bits (167), Expect = 9e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 328 DGEVIGIITLEDVFEELLQEEIVDETDEYVDVHK 361 >AQK93069.1 DUF21 domain-containing protein, partial [Zea mays] Length = 324 Score = 68.6 bits (166), Expect = 1e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEV+GIITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 263 DGEVVGIITLEDVFEELLQEEIVDETDEYVDVHK 296 >KDO74826.1 hypothetical protein CISIN_1g010325mg [Citrus sinensis] Length = 445 Score = 68.9 bits (167), Expect = 1e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 DGEVIGIITLEDVFEELLQEEIVDETDEFVDVHK 102 DGEVIGIITLEDVFEELLQEEIVDETDE+VDVHK Sbjct: 411 DGEVIGIITLEDVFEELLQEEIVDETDEYVDVHK 444