BLASTX nr result
ID: Panax25_contig00015579
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015579 (500 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM87636.1 hypothetical protein DCAR_031924 [Daucus carota subsp... 59 4e-07 KZM94204.1 hypothetical protein DCAR_017447 [Daucus carota subsp... 58 6e-07 >KZM87636.1 hypothetical protein DCAR_031924 [Daucus carota subsp. sativus] Length = 338 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/55 (43%), Positives = 36/55 (65%) Frame = -2 Query: 499 PHPSLICGLCCQAGVRWSDDEPTQMPLALLDSRMITRYSVWSGGDSHPRGLGFIF 335 P+ +++ LC +GVRW +E Q+P A +D I+R + W GG HPRGLG+I+ Sbjct: 182 PYGTIVTKLCRSSGVRWPANEQLQLPAAPIDHSAISRMTEWDGGVPHPRGLGYIY 236 >KZM94204.1 hypothetical protein DCAR_017447 [Daucus carota subsp. sativus] Length = 402 Score = 58.2 bits (139), Expect = 6e-07 Identities = 24/55 (43%), Positives = 36/55 (65%) Frame = -2 Query: 499 PHPSLICGLCCQAGVRWSDDEPTQMPLALLDSRMITRYSVWSGGDSHPRGLGFIF 335 P+ +++ LC +GVRW +E Q+P A +D I+R + W GG HPRGLG+I+ Sbjct: 246 PYGTIVTKLCRASGVRWPANEQLQLPAAPIDHSAISRMTEWDGGVPHPRGLGYIY 300