BLASTX nr result
ID: Panax25_contig00015443
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015443 (658 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO79179.1 hypothetical protein CISIN_1g028541mg [Citrus sinensis] 71 1e-11 ONM11380.1 Nicotinate phosphoribosyltransferase 2 [Zea mays] 70 3e-11 GAU26039.1 hypothetical protein TSUD_225000 [Trifolium subterran... 72 3e-11 XP_017242881.1 PREDICTED: nicotinate phosphoribosyltransferase 2... 72 6e-11 XP_011008522.1 PREDICTED: nicotinate phosphoribosyltransferase-l... 72 6e-11 XP_011043521.1 PREDICTED: nicotinate phosphoribosyltransferase-l... 72 6e-11 XP_002306477.1 nicotinate phosphoribosyltransferase family prote... 72 6e-11 KZN02128.1 hypothetical protein DCAR_010882 [Daucus carota subsp... 72 6e-11 XP_009760672.1 PREDICTED: nicotinate phosphoribosyltransferase-l... 72 6e-11 XP_009607892.1 PREDICTED: nicotinate phosphoribosyltransferase 2... 72 6e-11 XP_016474932.1 PREDICTED: nicotinate phosphoribosyltransferase 2... 72 6e-11 ONM11381.1 Nicotinate phosphoribosyltransferase 2 [Zea mays] ONM... 70 6e-11 XP_016508335.1 PREDICTED: nicotinate phosphoribosyltransferase 1... 71 8e-11 XP_013457412.1 nicotinate phosphoribosyltransferase-like protein... 71 9e-11 XP_009762307.1 PREDICTED: nicotinate phosphoribosyltransferase-l... 71 1e-10 XP_010270181.1 PREDICTED: nicotinate phosphoribosyltransferase 1... 71 1e-10 XP_010270171.1 PREDICTED: nicotinate phosphoribosyltransferase 1... 71 1e-10 OAY80130.1 Nicotinate phosphoribosyltransferase 2 [Ananas comosus] 71 1e-10 XP_010317798.1 PREDICTED: nicotinate phosphoribosyltransferase i... 71 1e-10 CDP02507.1 unnamed protein product [Coffea canephora] 71 1e-10 >KDO79179.1 hypothetical protein CISIN_1g028541mg [Citrus sinensis] Length = 207 Score = 71.2 bits (173), Expect = 1e-11 Identities = 34/38 (89%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDATR 546 VAGKSK L+EFGLRRAQGPDGGI ASKYCY+GGFDATR Sbjct: 170 VAGKSKMLLEFGLRRAQGPDGGIGASKYCYIGGFDATR 207 >ONM11380.1 Nicotinate phosphoribosyltransferase 2 [Zea mays] Length = 183 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSK L+EFGLRRAQGPDGGISAS+YCY+GGFDAT Sbjct: 74 VAGKSKNLLEFGLRRAQGPDGGISASRYCYMGGFDAT 110 >GAU26039.1 hypothetical protein TSUD_225000 [Trifolium subterraneum] Length = 522 Score = 72.4 bits (176), Expect = 3e-11 Identities = 34/38 (89%), Positives = 37/38 (97%), Gaps = 1/38 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDATR 546 VAGKSK L+EFGLRRAQGPDGG+SASKYCY+GGFDATR Sbjct: 163 VAGKSKTLLEFGLRRAQGPDGGVSASKYCYIGGFDATR 200 >XP_017242881.1 PREDICTED: nicotinate phosphoribosyltransferase 2 [Daucus carota subsp. sativus] Length = 557 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/37 (94%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSKLI-EFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSKL+ EFGLRRAQGPDGGISASKYCYLGGFDAT Sbjct: 167 VAGKSKLLLEFGLRRAQGPDGGISASKYCYLGGFDAT 203 >XP_011008522.1 PREDICTED: nicotinate phosphoribosyltransferase-like [Populus euphratica] Length = 559 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/37 (94%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSK L+EFGLRRAQGPDGGISASKYCYLGGFDAT Sbjct: 169 VAGKSKILLEFGLRRAQGPDGGISASKYCYLGGFDAT 205 >XP_011043521.1 PREDICTED: nicotinate phosphoribosyltransferase-like [Populus euphratica] Length = 559 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/37 (94%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSK L+EFGLRRAQGPDGGISASKYCYLGGFDAT Sbjct: 169 VAGKSKILLEFGLRRAQGPDGGISASKYCYLGGFDAT 205 >XP_002306477.1 nicotinate phosphoribosyltransferase family protein [Populus trichocarpa] EEE93473.1 nicotinate phosphoribosyltransferase family protein [Populus trichocarpa] Length = 559 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/37 (94%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSK L+EFGLRRAQGPDGGISASKYCYLGGFDAT Sbjct: 169 VAGKSKMLLEFGLRRAQGPDGGISASKYCYLGGFDAT 205 >KZN02128.1 hypothetical protein DCAR_010882 [Daucus carota subsp. sativus] Length = 568 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/37 (94%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSKLI-EFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSKL+ EFGLRRAQGPDGGISASKYCYLGGFDAT Sbjct: 167 VAGKSKLLLEFGLRRAQGPDGGISASKYCYLGGFDAT 203 >XP_009760672.1 PREDICTED: nicotinate phosphoribosyltransferase-like isoform X1 [Nicotiana sylvestris] Length = 570 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/38 (89%), Positives = 37/38 (97%), Gaps = 1/38 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDATR 546 VAG+SK L+EFGLRRAQGPDGGISASKYCY+GGFDATR Sbjct: 170 VAGRSKILLEFGLRRAQGPDGGISASKYCYMGGFDATR 207 >XP_009607892.1 PREDICTED: nicotinate phosphoribosyltransferase 2-like isoform X1 [Nicotiana tomentosiformis] Length = 570 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/38 (89%), Positives = 37/38 (97%), Gaps = 1/38 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDATR 546 VAG+SK L+EFGLRRAQGPDGGISASKYCY+GGFDATR Sbjct: 170 VAGRSKILLEFGLRRAQGPDGGISASKYCYMGGFDATR 207 >XP_016474932.1 PREDICTED: nicotinate phosphoribosyltransferase 2-like isoform X1 [Nicotiana tabacum] Length = 575 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/38 (89%), Positives = 37/38 (97%), Gaps = 1/38 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDATR 546 VAG+SK L+EFGLRRAQGPDGGISASKYCY+GGFDATR Sbjct: 175 VAGRSKILLEFGLRRAQGPDGGISASKYCYMGGFDATR 212 >ONM11381.1 Nicotinate phosphoribosyltransferase 2 [Zea mays] ONM11384.1 Nicotinate phosphoribosyltransferase 2 [Zea mays] Length = 229 Score = 69.7 bits (169), Expect = 6e-11 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSK L+EFGLRRAQGPDGGISAS+YCY+GGFDAT Sbjct: 74 VAGKSKNLLEFGLRRAQGPDGGISASRYCYMGGFDAT 110 >XP_016508335.1 PREDICTED: nicotinate phosphoribosyltransferase 1-like [Nicotiana tabacum] XP_016508336.1 PREDICTED: nicotinate phosphoribosyltransferase 1-like [Nicotiana tabacum] Length = 394 Score = 70.9 bits (172), Expect = 8e-11 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSKLI-EFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSKL+ EFGLRRAQGPDGGISASKYCY+GGFDAT Sbjct: 175 VAGKSKLLLEFGLRRAQGPDGGISASKYCYMGGFDAT 211 >XP_013457412.1 nicotinate phosphoribosyltransferase-like protein [Medicago truncatula] KEH31443.1 nicotinate phosphoribosyltransferase-like protein [Medicago truncatula] Length = 426 Score = 70.9 bits (172), Expect = 9e-11 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSK L+EFGLRRAQGPDGGISASKYCY+GGFDAT Sbjct: 170 VAGKSKTLLEFGLRRAQGPDGGISASKYCYIGGFDAT 206 >XP_009762307.1 PREDICTED: nicotinate phosphoribosyltransferase-like isoform X2 [Nicotiana sylvestris] Length = 494 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSKLI-EFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSKL+ EFGLRRAQGPDGGISASKYCY+GGFDAT Sbjct: 175 VAGKSKLLLEFGLRRAQGPDGGISASKYCYMGGFDAT 211 >XP_010270181.1 PREDICTED: nicotinate phosphoribosyltransferase 1-like isoform X3 [Nelumbo nucifera] Length = 511 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSK L+EFGLRRAQGPDGGISASKYCY+GGFDAT Sbjct: 169 VAGKSKVLLEFGLRRAQGPDGGISASKYCYIGGFDAT 205 >XP_010270171.1 PREDICTED: nicotinate phosphoribosyltransferase 1-like isoform X2 [Nelumbo nucifera] Length = 520 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSK L+EFGLRRAQGPDGGISASKYCY+GGFDAT Sbjct: 169 VAGKSKVLLEFGLRRAQGPDGGISASKYCYIGGFDAT 205 >OAY80130.1 Nicotinate phosphoribosyltransferase 2 [Ananas comosus] Length = 521 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSK-LIEFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSK L+EFGLRRAQGPDGGISASKYCY+GGFDAT Sbjct: 164 VAGKSKVLLEFGLRRAQGPDGGISASKYCYIGGFDAT 200 >XP_010317798.1 PREDICTED: nicotinate phosphoribosyltransferase isoform X2 [Solanum lycopersicum] Length = 527 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSKLI-EFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSKL+ EFGLRRAQGPDGGISASKYCY+GGFDAT Sbjct: 176 VAGKSKLLLEFGLRRAQGPDGGISASKYCYMGGFDAT 212 >CDP02507.1 unnamed protein product [Coffea canephora] Length = 537 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 656 VAGKSKLI-EFGLRRAQGPDGGISASKYCYLGGFDAT 549 VAGKSKL+ EFGLRRAQGPDGGISASKYCY+GGFDAT Sbjct: 147 VAGKSKLLLEFGLRRAQGPDGGISASKYCYMGGFDAT 183