BLASTX nr result
ID: Panax25_contig00015333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015333 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT51456.1 Auxin-induced in root cultures protein 12, partial [A... 60 6e-08 XP_006826524.1 PREDICTED: protein disulfide isomerase-like 5-4 [... 59 2e-07 XP_011089022.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 57 4e-07 XP_017229219.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 57 5e-07 XP_019161611.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 57 5e-07 XP_011089631.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 57 7e-07 XP_006361325.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 56 1e-06 XP_012835216.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 56 1e-06 XP_019178461.1 PREDICTED: cytochrome b561 and DOMON domain-conta... 55 2e-06 CDP03944.1 unnamed protein product [Coffea canephora] 55 3e-06 >JAT51456.1 Auxin-induced in root cultures protein 12, partial [Anthurium amnicola] Length = 414 Score = 60.1 bits (144), Expect = 6e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 403 SVTGDVPDKHAFLPANLISKGTLDLLSGQTTGSGGDSRLSMKN 275 SVTG+ PDKHA AN++SKGTLDL+SG TT +G DSRL +N Sbjct: 193 SVTGEAPDKHAMEQANMVSKGTLDLVSGGTTAAGTDSRLRERN 235 >XP_006826524.1 PREDICTED: protein disulfide isomerase-like 5-4 [Amborella trichopoda] ERM93761.1 hypothetical protein AMTR_s00004p00269230 [Amborella trichopoda] Length = 484 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 226 TMENLLAPISLESHKVALEDKSGKTSDDAKRLAPLTG 116 TME+L+API LESHK+ALEDKS +TSD KR APLTG Sbjct: 256 TMESLVAPIPLESHKLALEDKSNRTSDSVKRPAPLTG 292 >XP_011089022.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290 [Sesamum indicum] Length = 295 Score = 57.4 bits (137), Expect = 4e-07 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = -2 Query: 403 SVTGDVPDKHAFLPANLISKGTLDLLSGQTTG-SGGDSRLSMKN 275 SVT VPDKH F PANL SKG+LDLL GQ+ G SGGDSR +N Sbjct: 76 SVTDGVPDKHEFQPANLNSKGSLDLLRGQSDGASGGDSRTQKRN 119 >XP_017229219.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290-like [Daucus carota subsp. sativus] KZN12103.1 hypothetical protein DCAR_004759 [Daucus carota subsp. sativus] Length = 390 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/39 (76%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = -2 Query: 406 ASVTGDVPDKHAFLPANLISKGTLDLLSGQT--TGSGGD 296 ASVTG VPDKH F PANL SKGTLDL SGQ+ TG GGD Sbjct: 158 ASVTGGVPDKHDFQPANLNSKGTLDLASGQSSATGGGGD 196 >XP_019161611.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290-like [Ipomoea nil] Length = 391 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 406 ASVTGDVPDKHAFLPANLISKGTLDLLSG-QTTGSGGDSRLSMKN 275 +SVT VPD+HA P NL SKGT+DLL G TGS GDSRL+ KN Sbjct: 165 SSVTAGVPDRHALQPVNLNSKGTIDLLKGVSNTGSSGDSRLTKKN 209 >XP_011089631.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290-like [Sesamum indicum] Length = 396 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/44 (63%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -2 Query: 403 SVTGDVPDKHAFLPANLISKGTLDLLSGQTT-GSGGDSRLSMKN 275 S+TG VPDKH F P NL SKG+LDLL GQ+T G+GG+SR +N Sbjct: 164 SITGGVPDKHEFQPENLNSKGSLDLLRGQSTAGAGGNSRTKKRN 207 >XP_006361325.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290-like [Solanum tuberosum] Length = 381 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = -2 Query: 403 SVTGDVPDKHAFLPANLISKGTLDLLSGQT-TGSGGDSRLSMKN 275 SVTG P KH F PANL SKGT DLLSG++ T + GDSR+S KN Sbjct: 163 SVTGGFPAKHGFQPANLNSKGTFDLLSGESKTSASGDSRVSRKN 206 >XP_012835216.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290 [Erythranthe guttata] EYU39174.1 hypothetical protein MIMGU_mgv1a007561mg [Erythranthe guttata] Length = 403 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 3/46 (6%) Frame = -2 Query: 403 SVTGDVPDKHAFLPANLISKGTLDLLSGQTT---GSGGDSRLSMKN 275 SVTG VPDKH F PANL SKG+LDLL GQ+T GG+SR + +N Sbjct: 168 SVTGGVPDKHEFQPANLNSKGSLDLLRGQSTVAPAGGGNSRANKRN 213 >XP_019178461.1 PREDICTED: cytochrome b561 and DOMON domain-containing protein At3g25290-like [Ipomoea nil] Length = 394 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/45 (57%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -2 Query: 406 ASVTGDVPDKHAFLPANLISKGTLDLLSGQTTG-SGGDSRLSMKN 275 +SVTG VPD+H F PANL SKG++DLL G++ G + GDSR+ +N Sbjct: 165 SSVTGGVPDRHDFQPANLNSKGSIDLLKGESNGDTSGDSRIKKRN 209 >CDP03944.1 unnamed protein product [Coffea canephora] Length = 400 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/48 (60%), Positives = 34/48 (70%), Gaps = 4/48 (8%) Frame = -2 Query: 406 ASVTGDVPDKHAFLPANLISKGTLDLLSGQTTGSG----GDSRLSMKN 275 ASVT VPDKH F PANL +KG+LDLLSGQ++ G DSR+ KN Sbjct: 165 ASVTNGVPDKHDFSPANLNAKGSLDLLSGQSSSGGSSSSSDSRVKRKN 212