BLASTX nr result
ID: Panax25_contig00015256
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015256 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AGG39698.1 aquaporin protein AQU20 [Camellia sinensis] 83 9e-17 XP_004302154.1 PREDICTED: aquaporin SIP1-2 [Fragaria vesca subsp... 80 7e-16 ANW81869.1 aquaporin SIP1-2, partial [Trifolium repens] 79 1e-15 XP_019254350.1 PREDICTED: aquaporin SIP1-1-like [Nicotiana atten... 80 1e-15 XP_009772065.1 PREDICTED: aquaporin SIP1-1-like [Nicotiana sylve... 80 1e-15 XP_017243889.1 PREDICTED: aquaporin SIP1-1-like [Daucus carota s... 78 5e-15 OAY66797.1 Aquaporin SIP1-2, partial [Ananas comosus] 77 7e-15 OAY63257.1 Aquaporin SIP1-2 [Ananas comosus] 77 8e-15 XP_009611953.1 PREDICTED: aquaporin SIP1-2-like [Nicotiana tomen... 78 8e-15 CBI29914.3 unnamed protein product, partial [Vitis vinifera] 75 2e-14 CDP19408.1 unnamed protein product [Coffea canephora] 77 2e-14 XP_011085096.1 PREDICTED: aquaporin SIP1-1-like [Sesamum indicum... 77 2e-14 XP_009353171.1 PREDICTED: aquaporin SIP1-2 [Pyrus x bretschneideri] 76 4e-14 XP_008357207.1 PREDICTED: aquaporin SIP1-2-like [Malus domestica... 76 4e-14 XP_020101992.1 aquaporin SIP1-2 [Ananas comosus] 75 7e-14 ACH72790.1 small basic intrinsic protein 1-2 [Olea europaea] 75 8e-14 KYP60176.1 putative aquaporin SIP1-2 [Cajanus cajan] 75 8e-14 XP_010274927.1 PREDICTED: aquaporin SIP1-2 [Nelumbo nucifera] XP... 75 1e-13 NP_001267877.1 small basic intrinsic protein 1 [Vitis vinifera] ... 75 1e-13 EAY95175.1 hypothetical protein OsI_16993 [Oryza sativa Indica G... 74 1e-13 >AGG39698.1 aquaporin protein AQU20 [Camellia sinensis] Length = 236 Score = 82.8 bits (203), Expect = 9e-17 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTWEQFYVYWICPF+GAIL+AWVFR+LFPPP+K+KKA Sbjct: 200 NTWEQFYVYWICPFIGAILAAWVFRILFPPPIKEKKA 236 >XP_004302154.1 PREDICTED: aquaporin SIP1-2 [Fragaria vesca subsp. vesca] Length = 237 Score = 80.5 bits (197), Expect = 7e-16 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTWEQFYVYWICPF+GAIL++WVFR LFPPP KQKKA Sbjct: 201 NTWEQFYVYWICPFIGAILASWVFRALFPPPTKQKKA 237 >ANW81869.1 aquaporin SIP1-2, partial [Trifolium repens] Length = 186 Score = 78.6 bits (192), Expect = 1e-15 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTW+QFYVYWICPF GAIL+AW+FR +FPPPVKQKK+ Sbjct: 150 NTWDQFYVYWICPFTGAILAAWIFRAIFPPPVKQKKS 186 >XP_019254350.1 PREDICTED: aquaporin SIP1-1-like [Nicotiana attenuata] OIS97665.1 aquaporin sip1-2 [Nicotiana attenuata] Length = 243 Score = 79.7 bits (195), Expect = 1e-15 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKK 294 NTWEQFYVYWICPFVGAI++AW FR LFPPPVKQKK Sbjct: 201 NTWEQFYVYWICPFVGAIMAAWTFRALFPPPVKQKK 236 >XP_009772065.1 PREDICTED: aquaporin SIP1-1-like [Nicotiana sylvestris] XP_016461483.1 PREDICTED: aquaporin SIP1-1-like [Nicotiana tabacum] Length = 243 Score = 79.7 bits (195), Expect = 1e-15 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKK 294 NTWEQFYVYWICPFVGAI++AW FR LFPPPVKQKK Sbjct: 201 NTWEQFYVYWICPFVGAIMAAWTFRALFPPPVKQKK 236 >XP_017243889.1 PREDICTED: aquaporin SIP1-1-like [Daucus carota subsp. sativus] XP_017243890.1 PREDICTED: aquaporin SIP1-1-like [Daucus carota subsp. sativus] XP_017243891.1 PREDICTED: aquaporin SIP1-1-like [Daucus carota subsp. sativus] XP_017243892.1 PREDICTED: aquaporin SIP1-1-like [Daucus carota subsp. sativus] XP_017243893.1 PREDICTED: aquaporin SIP1-1-like [Daucus carota subsp. sativus] Length = 236 Score = 78.2 bits (191), Expect = 5e-15 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTW+ YVYWICPFVGAILSAW+FR +FPPPVKQKKA Sbjct: 200 NTWDHLYVYWICPFVGAILSAWIFRAIFPPPVKQKKA 236 >OAY66797.1 Aquaporin SIP1-2, partial [Ananas comosus] Length = 216 Score = 77.4 bits (189), Expect = 7e-15 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTWEQFYVYWICPFVGAIL+AWVFR++FPP VK KKA Sbjct: 180 NTWEQFYVYWICPFVGAILAAWVFRLIFPPAVKVKKA 216 >OAY63257.1 Aquaporin SIP1-2 [Ananas comosus] Length = 221 Score = 77.4 bits (189), Expect = 8e-15 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTWEQFYVYWICPFVGAIL+AWVFR++FPP VK KKA Sbjct: 185 NTWEQFYVYWICPFVGAILAAWVFRLIFPPAVKVKKA 221 >XP_009611953.1 PREDICTED: aquaporin SIP1-2-like [Nicotiana tomentosiformis] XP_016492107.1 PREDICTED: aquaporin SIP1-2-like [Nicotiana tabacum] Length = 242 Score = 77.8 bits (190), Expect = 8e-15 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQK 297 NTWEQFYVYWICPFVGAI++AW FR LFPPPVKQK Sbjct: 201 NTWEQFYVYWICPFVGAIMAAWTFRALFPPPVKQK 235 >CBI29914.3 unnamed protein product, partial [Vitis vinifera] Length = 147 Score = 74.7 bits (182), Expect = 2e-14 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTW+Q YVYWICPF+GAIL+AWVFR LFP P KQKKA Sbjct: 111 NTWDQLYVYWICPFIGAILAAWVFRFLFPAPTKQKKA 147 >CDP19408.1 unnamed protein product [Coffea canephora] Length = 240 Score = 76.6 bits (187), Expect = 2e-14 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKK 294 NTWEQFYVYWICPF GAIL+AWVF+ LFPPP K+KK Sbjct: 204 NTWEQFYVYWICPFAGAILAAWVFKALFPPPTKEKK 239 >XP_011085096.1 PREDICTED: aquaporin SIP1-1-like [Sesamum indicum] XP_011085098.1 PREDICTED: aquaporin SIP1-1-like [Sesamum indicum] XP_011085099.1 PREDICTED: aquaporin SIP1-1-like [Sesamum indicum] Length = 241 Score = 76.6 bits (187), Expect = 2e-14 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTWEQ YVYWICPF+GAI++AWVFR LFPPP KQKK+ Sbjct: 205 NTWEQLYVYWICPFIGAIVAAWVFRFLFPPPTKQKKS 241 >XP_009353171.1 PREDICTED: aquaporin SIP1-2 [Pyrus x bretschneideri] Length = 241 Score = 75.9 bits (185), Expect = 4e-14 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKK 294 NTWEQFYVYWICPF+GAIL+ WVFRVLFPPP +KK Sbjct: 202 NTWEQFYVYWICPFIGAILAGWVFRVLFPPPPSKKK 237 >XP_008357207.1 PREDICTED: aquaporin SIP1-2-like [Malus domestica] XP_008357208.1 PREDICTED: aquaporin SIP1-2-like [Malus domestica] Length = 242 Score = 75.9 bits (185), Expect = 4e-14 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKK 294 NTWEQFYVYWICPF+GAIL+ WVFRVLFPPP +KK Sbjct: 202 NTWEQFYVYWICPFIGAILAGWVFRVLFPPPPSKKK 237 >XP_020101992.1 aquaporin SIP1-2 [Ananas comosus] Length = 237 Score = 75.1 bits (183), Expect = 7e-14 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 398 TWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 TWEQFYVYWICPFVGAIL+AWVFR++FPP VK KKA Sbjct: 202 TWEQFYVYWICPFVGAILAAWVFRLIFPPAVKVKKA 237 >ACH72790.1 small basic intrinsic protein 1-2 [Olea europaea] Length = 241 Score = 75.1 bits (183), Expect = 8e-14 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTWEQFYVYWICPFVGAIL+AW FR LFPPP Q KA Sbjct: 202 NTWEQFYVYWICPFVGAILAAWTFRFLFPPPSNQHKA 238 >KYP60176.1 putative aquaporin SIP1-2 [Cajanus cajan] Length = 245 Score = 75.1 bits (183), Expect = 8e-14 Identities = 30/38 (78%), Positives = 37/38 (97%), Gaps = 1/38 (2%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPP-VKQKKA 291 NTW+QFYVYWICPF+GAIL++W+FR++FPPP VKQKKA Sbjct: 208 NTWDQFYVYWICPFIGAILASWLFRIVFPPPVVKQKKA 245 >XP_010274927.1 PREDICTED: aquaporin SIP1-2 [Nelumbo nucifera] XP_010274928.1 PREDICTED: aquaporin SIP1-2 [Nelumbo nucifera] XP_010274929.1 PREDICTED: aquaporin SIP1-2 [Nelumbo nucifera] Length = 237 Score = 74.7 bits (182), Expect = 1e-13 Identities = 30/38 (78%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPP-VKQKKA 291 NTWEQFYVYWICPF+GAIL+ W+FR +FPPP +KQKKA Sbjct: 200 NTWEQFYVYWICPFIGAILAGWIFRFVFPPPQIKQKKA 237 >NP_001267877.1 small basic intrinsic protein 1 [Vitis vinifera] ABD46741.1 small basic intrinsic protein 1 [Vitis vinifera] CAN79588.1 hypothetical protein VITISV_037967 [Vitis vinifera] Length = 238 Score = 74.7 bits (182), Expect = 1e-13 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTW+Q YVYWICPF+GAIL+AWVFR LFP P KQKKA Sbjct: 202 NTWDQLYVYWICPFIGAILAAWVFRFLFPAPTKQKKA 238 >EAY95175.1 hypothetical protein OsI_16993 [Oryza sativa Indica Group] Length = 217 Score = 74.3 bits (181), Expect = 1e-13 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 401 NTWEQFYVYWICPFVGAILSAWVFRVLFPPPVKQKKA 291 NTWEQFYVYWICPFVGA+L+AWVFR +FPPP + KA Sbjct: 178 NTWEQFYVYWICPFVGAVLAAWVFRAVFPPPAPKPKA 214