BLASTX nr result
ID: Panax25_contig00015203
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015203 (638 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002272867.1 PREDICTED: exocyst complex component EXO70B1 [Vit... 60 3e-07 CBI15871.3 unnamed protein product, partial [Vitis vinifera] 60 3e-07 XP_015931930.1 PREDICTED: exocyst complex component EXO70B1 [Ara... 60 6e-07 XP_016166383.1 PREDICTED: exocyst complex component EXO70B1-like... 60 6e-07 XP_016477966.1 PREDICTED: exocyst complex component EXO70B1-like... 59 1e-06 XP_009594732.1 PREDICTED: exocyst complex component EXO70B1 [Nic... 59 1e-06 XP_019240870.1 PREDICTED: exocyst complex component EXO70B1 [Nic... 59 1e-06 XP_016484220.1 PREDICTED: exocyst complex component EXO70B1 [Nic... 59 1e-06 XP_009783678.1 PREDICTED: exocyst complex component EXO70B1 [Nic... 59 1e-06 XP_006355297.1 PREDICTED: exocyst complex component EXO70B1 [Sol... 59 1e-06 XP_015085512.1 PREDICTED: exocyst complex component EXO70B1 [Sol... 59 1e-06 CAA78112.1 unnamed protein product [Solanum lycopersicum] prf||1... 59 1e-06 NP_001234392.2 exocyst subunit exo70 family protein [Solanum lyc... 59 1e-06 XP_010099444.1 Exocyst complex component 7 [Morus notabilis] EXB... 59 1e-06 XP_010446178.1 PREDICTED: exocyst complex component EXO70B1-like... 59 1e-06 BAH56852.1 AT5G58430 [Arabidopsis thaliana] BAH56898.1 AT5G58430... 59 1e-06 CDY70944.1 BnaAnng35640D, partial [Brassica napus] 59 1e-06 XP_016542090.1 PREDICTED: LOW QUALITY PROTEIN: exocyst complex c... 59 1e-06 XP_013683589.1 PREDICTED: exocyst complex component EXO70B1 [Bra... 59 1e-06 XP_013620504.1 PREDICTED: exocyst complex component EXO70B1 [Bra... 59 1e-06 >XP_002272867.1 PREDICTED: exocyst complex component EXO70B1 [Vitis vinifera] CAN59816.1 hypothetical protein VITISV_020320 [Vitis vinifera] Length = 627 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFS+A+NLSFMEV RGSTIQ Sbjct: 281 FPSERRLCDRVFFGFSSAANLSFMEVCRGSTIQ 313 >CBI15871.3 unnamed protein product, partial [Vitis vinifera] Length = 649 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFS+A+NLSFMEV RGSTIQ Sbjct: 279 FPSERRLCDRVFFGFSSAANLSFMEVCRGSTIQ 311 >XP_015931930.1 PREDICTED: exocyst complex component EXO70B1 [Arachis duranensis] Length = 618 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFSAA++LSFMEV RGSTIQ Sbjct: 260 FPSERRLCDRVFFGFSAAADLSFMEVCRGSTIQ 292 >XP_016166383.1 PREDICTED: exocyst complex component EXO70B1-like [Arachis ipaensis] Length = 643 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFSAA++LSFMEV RGSTIQ Sbjct: 285 FPSERRLCDRVFFGFSAAADLSFMEVCRGSTIQ 317 >XP_016477966.1 PREDICTED: exocyst complex component EXO70B1-like, partial [Nicotiana tabacum] Length = 477 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 120 FPSERRLCDRVFFGFNSVSDLSFMEVSRGSTIQ 152 >XP_009594732.1 PREDICTED: exocyst complex component EXO70B1 [Nicotiana tomentosiformis] Length = 622 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 265 FPSERRLCDRVFFGFNSVSDLSFMEVSRGSTIQ 297 >XP_019240870.1 PREDICTED: exocyst complex component EXO70B1 [Nicotiana attenuata] OIT19915.1 exocyst complex component exo70b1 [Nicotiana attenuata] Length = 625 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 268 FPSERRLCDRVFFGFNSVSDLSFMEVSRGSTIQ 300 >XP_016484220.1 PREDICTED: exocyst complex component EXO70B1 [Nicotiana tabacum] Length = 625 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 268 FPSERRLCDRVFFGFNSVSDLSFMEVSRGSTIQ 300 >XP_009783678.1 PREDICTED: exocyst complex component EXO70B1 [Nicotiana sylvestris] Length = 625 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 268 FPSERRLCDRVFFGFNSVSDLSFMEVSRGSTIQ 300 >XP_006355297.1 PREDICTED: exocyst complex component EXO70B1 [Solanum tuberosum] Length = 627 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 267 FPSERRLCDRVFFGFNSVSDLSFMEVSRGSTIQ 299 >XP_015085512.1 PREDICTED: exocyst complex component EXO70B1 [Solanum pennellii] Length = 630 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 269 FPSERRLCDRVFFGFNSVSDLSFMEVSRGSTIQ 301 >CAA78112.1 unnamed protein product [Solanum lycopersicum] prf||1909366A Leu zipper protein Length = 631 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 270 FPSERRLCDRVFFGFNSVSDLSFMEVSRGSTIQ 302 >NP_001234392.2 exocyst subunit exo70 family protein [Solanum lycopersicum] AEW69792.1 Hop-interacting protein THI029 [Solanum lycopersicum] Length = 631 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 270 FPSERRLCDRVFFGFNSVSDLSFMEVSRGSTIQ 302 >XP_010099444.1 Exocyst complex component 7 [Morus notabilis] EXB78519.1 Exocyst complex component 7 [Morus notabilis] Length = 636 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFS+A++LSFMEV RGSTIQ Sbjct: 281 FPSERRLVDRVFFGFSSAADLSFMEVCRGSTIQ 313 >XP_010446178.1 PREDICTED: exocyst complex component EXO70B1-like [Camelina sativa] Length = 353 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFS+A++LSFMEV RGSTIQ Sbjct: 280 FPSERRLCDRVFFGFSSAADLSFMEVCRGSTIQ 312 >BAH56852.1 AT5G58430 [Arabidopsis thaliana] BAH56898.1 AT5G58430 [Arabidopsis thaliana] Length = 410 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFS+A++LSFMEV RGSTIQ Sbjct: 279 FPSERRLCDRVFFGFSSAADLSFMEVCRGSTIQ 311 >CDY70944.1 BnaAnng35640D, partial [Brassica napus] Length = 424 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFS+A++LSFMEV RGSTIQ Sbjct: 263 FPSERRLCDRVFFGFSSAADLSFMEVCRGSTIQ 295 >XP_016542090.1 PREDICTED: LOW QUALITY PROTEIN: exocyst complex component EXO70B1 [Capsicum annuum] Length = 610 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGF++ S+LSFMEVSRGSTIQ Sbjct: 250 FPSERRLCDRVFFGFTSLSDLSFMEVSRGSTIQ 282 >XP_013683589.1 PREDICTED: exocyst complex component EXO70B1 [Brassica napus] Length = 615 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFS+A++LSFMEV RGSTIQ Sbjct: 268 FPSERRLCDRVFFGFSSAADLSFMEVCRGSTIQ 300 >XP_013620504.1 PREDICTED: exocyst complex component EXO70B1 [Brassica oleracea var. oleracea] Length = 615 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 379 FPSERRLYDRVFFGFSAASNLSFMEVSRGSTIQ 477 FPSERRL DRVFFGFS+A++LSFMEV RGSTIQ Sbjct: 268 FPSERRLCDRVFFGFSSAADLSFMEVCRGSTIQ 300