BLASTX nr result
ID: Panax25_contig00015197
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015197 (780 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAA51077.1 nuclear located protein [Daucus carota] 64 8e-09 P37706.2 RecName: Full=Ribosome-recycling factor, chloroplastic;... 64 2e-08 XP_016168198.1 PREDICTED: ribosome-recycling factor, chloroplast... 60 2e-08 XP_017253814.1 PREDICTED: ribosome-recycling factor, chloroplast... 64 3e-08 KZM95179.1 hypothetical protein DCAR_018421 [Daucus carota subsp... 64 3e-08 XP_006444065.1 hypothetical protein CICLE_v10021605mg [Citrus cl... 62 5e-08 KZV22539.1 hypothetical protein F511_09061 [Dorcoceras hygrometr... 62 5e-08 KJB42102.1 hypothetical protein B456_007G137300 [Gossypium raimo... 61 6e-08 XP_017969561.1 PREDICTED: ribosome-recycling factor, chloroplast... 63 6e-08 XP_017969560.1 PREDICTED: ribosome-recycling factor, chloroplast... 63 6e-08 EOX94756.1 Ribosome recycling factor isoform 3 [Theobroma cacao] 63 6e-08 XP_017969559.1 PREDICTED: ribosome-recycling factor, chloroplast... 63 7e-08 EOX94755.1 Ribosome recycling factor isoform 2 [Theobroma cacao] 63 7e-08 CAN77406.1 hypothetical protein VITISV_026196 [Vitis vinifera] 62 9e-08 EEF41699.1 ribosome recycling factor, putative [Ricinus communis] 62 1e-07 XP_015575692.1 PREDICTED: ribosome-recycling factor, chloroplast... 62 1e-07 KYP43337.1 hypothetical protein KK1_035240 [Cajanus cajan] 62 1e-07 XP_017413743.1 PREDICTED: ribosome-recycling factor, chloroplast... 62 1e-07 XP_014512371.1 PREDICTED: ribosome-recycling factor, chloroplast... 62 1e-07 KOM35034.1 hypothetical protein LR48_Vigan02g118400 [Vigna angul... 62 1e-07 >CAA51077.1 nuclear located protein [Daucus carota] Length = 167 Score = 63.5 bits (153), Expect = 8e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTP SLKSIAQISTPDSSSL+VNPYDKS Sbjct: 24 VEYYGTPTSLKSIAQISTPDSSSLLVNPYDKS 55 >P37706.2 RecName: Full=Ribosome-recycling factor, chloroplastic; Short=RRF; AltName: Full=Nuclear located protein D2; AltName: Full=Ribosome-releasing factor, chloroplastic; Flags: Precursor Length = 227 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTP SLKSIAQISTPDSSSL+VNPYDKS Sbjct: 84 VEYYGTPTSLKSIAQISTPDSSSLLVNPYDKS 115 >XP_016168198.1 PREDICTED: ribosome-recycling factor, chloroplastic-like [Arachis ipaensis] Length = 87 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYG+PVSLKSIAQISTPD+SSL+V PYDKS Sbjct: 12 VEYYGSPVSLKSIAQISTPDASSLLVQPYDKS 43 >XP_017253814.1 PREDICTED: ribosome-recycling factor, chloroplastic [Daucus carota subsp. sativus] Length = 270 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTP SLKSIAQISTPDSSSL+VNPYDKS Sbjct: 127 VEYYGTPTSLKSIAQISTPDSSSLLVNPYDKS 158 >KZM95179.1 hypothetical protein DCAR_018421 [Daucus carota subsp. sativus] Length = 283 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTP SLKSIAQISTPDSSSL+VNPYDKS Sbjct: 140 VEYYGTPTSLKSIAQISTPDSSSLLVNPYDKS 171 >XP_006444065.1 hypothetical protein CICLE_v10021605mg [Citrus clementina] ESR57305.1 hypothetical protein CICLE_v10021605mg [Citrus clementina] Length = 179 Score = 61.6 bits (148), Expect = 5e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKSR 20 VEYYG+PVSLKSIAQI+TPDSSSL++ PYDKSR Sbjct: 133 VEYYGSPVSLKSIAQINTPDSSSLLIQPYDKSR 165 >KZV22539.1 hypothetical protein F511_09061 [Dorcoceras hygrometricum] Length = 182 Score = 61.6 bits (148), Expect = 5e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPD+SSL+V PYDKS Sbjct: 30 VEYYGTPVSLKSIAQISTPDASSLLVQPYDKS 61 >KJB42102.1 hypothetical protein B456_007G137300 [Gossypium raimondii] Length = 171 Score = 61.2 bits (147), Expect = 6e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKSR 20 VEYYGTPVSLKSIAQISTP+SSSL++ P+DKSR Sbjct: 133 VEYYGTPVSLKSIAQISTPESSSLLIQPFDKSR 165 >XP_017969561.1 PREDICTED: ribosome-recycling factor, chloroplastic isoform X3 [Theobroma cacao] EOX94754.1 Ribosome recycling factor isoform 1 [Theobroma cacao] Length = 277 Score = 62.8 bits (151), Expect = 6e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPDSSSL+V PYDKS Sbjct: 134 VEYYGTPVSLKSIAQISTPDSSSLLVQPYDKS 165 >XP_017969560.1 PREDICTED: ribosome-recycling factor, chloroplastic isoform X2 [Theobroma cacao] Length = 278 Score = 62.8 bits (151), Expect = 6e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPDSSSL+V PYDKS Sbjct: 134 VEYYGTPVSLKSIAQISTPDSSSLLVQPYDKS 165 >EOX94756.1 Ribosome recycling factor isoform 3 [Theobroma cacao] Length = 285 Score = 62.8 bits (151), Expect = 6e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPDSSSL+V PYDKS Sbjct: 134 VEYYGTPVSLKSIAQISTPDSSSLLVQPYDKS 165 >XP_017969559.1 PREDICTED: ribosome-recycling factor, chloroplastic isoform X1 [Theobroma cacao] Length = 300 Score = 62.8 bits (151), Expect = 7e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPDSSSL+V PYDKS Sbjct: 134 VEYYGTPVSLKSIAQISTPDSSSLLVQPYDKS 165 >EOX94755.1 Ribosome recycling factor isoform 2 [Theobroma cacao] Length = 300 Score = 62.8 bits (151), Expect = 7e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPDSSSL+V PYDKS Sbjct: 134 VEYYGTPVSLKSIAQISTPDSSSLLVQPYDKS 165 >CAN77406.1 hypothetical protein VITISV_026196 [Vitis vinifera] Length = 222 Score = 61.6 bits (148), Expect = 9e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPDS+SL+V PYDKS Sbjct: 131 VEYYGTPVSLKSIAQISTPDSASLLVQPYDKS 162 >EEF41699.1 ribosome recycling factor, putative [Ricinus communis] Length = 247 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPD+SSL+V PYDKS Sbjct: 119 VEYYGTPVSLKSIAQISTPDASSLLVQPYDKS 150 >XP_015575692.1 PREDICTED: ribosome-recycling factor, chloroplastic [Ricinus communis] Length = 265 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPD+SSL+V PYDKS Sbjct: 122 VEYYGTPVSLKSIAQISTPDASSLLVQPYDKS 153 >KYP43337.1 hypothetical protein KK1_035240 [Cajanus cajan] Length = 266 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPD+SSL+V PYDKS Sbjct: 122 VEYYGTPVSLKSIAQISTPDASSLLVQPYDKS 153 >XP_017413743.1 PREDICTED: ribosome-recycling factor, chloroplastic [Vigna angularis] BAT95597.1 hypothetical protein VIGAN_08235300 [Vigna angularis var. angularis] Length = 266 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPD+SSL+V PYDKS Sbjct: 123 VEYYGTPVSLKSIAQISTPDASSLLVQPYDKS 154 >XP_014512371.1 PREDICTED: ribosome-recycling factor, chloroplastic [Vigna radiata var. radiata] Length = 266 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPD+SSL+V PYDKS Sbjct: 123 VEYYGTPVSLKSIAQISTPDASSLLVQPYDKS 154 >KOM35034.1 hypothetical protein LR48_Vigan02g118400 [Vigna angularis] Length = 266 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 118 VEYYGTPVSLKSIAQISTPDSSSLVVNPYDKS 23 VEYYGTPVSLKSIAQISTPD+SSL+V PYDKS Sbjct: 123 VEYYGTPVSLKSIAQISTPDASSLLVQPYDKS 154