BLASTX nr result
ID: Panax25_contig00015136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015136 (1220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFN85350.1 ATP synthase CF0 subunit IV, partial (chloroplast) [A... 90 4e-18 AFN85358.1 ATP synthase CF0 subunit IV, partial (chloroplast) [E... 90 5e-18 AFN85351.1 ATP synthase CF0 subunit IV, partial (chloroplast) [B... 90 5e-18 AFN85349.1 ATP synthase CF0 subunit IV, partial (chloroplast) [A... 90 5e-18 ALI89392.1 AtpI, partial (chloroplast) [Calatola mollis] 90 5e-18 BAU22214.1 ATP synthase CF0 A subunit, partial (chloroplast) [To... 87 5e-18 BAU22215.1 ATP synthase CF0 A subunit, partial (chloroplast) [To... 87 5e-18 AGL75838.1 ATP synthase CF0 A subunit, partial (chloroplast) [Ab... 88 7e-18 KQK91810.1 hypothetical protein SETIT_038243mg [Setaria italica] 88 8e-18 AGL75841.1 ATP synthase CF0 A subunit, partial (chloroplast) [Ab... 88 2e-17 AGL75820.1 ATP synthase CF0 A subunit, partial (chloroplast) [Ab... 88 2e-17 AGL75795.1 ATP synthase CF0 A subunit, partial (chloroplast) [Ab... 88 2e-17 ANP26093.1 ATP synthase CF0 subunit IV (plastid) [Tacca chantrieri] 91 4e-17 YP_001294340.1 ATP synthase CF0 A subunit [Dioscorea elephantipe... 91 4e-17 AKJ77542.1 ATP synthase CF0 A subunit (chloroplast) [Dioscorea n... 91 4e-17 YP_009139089.1 ATP synthase CF0 subunit IV (chloroplast) [Diosco... 91 4e-17 YP_009033873.1 ATP synthase CF0 A subunit (plastid) [Dioscorea r... 91 4e-17 NP_904087.1 ATP synthase CF0 A subunit [Amborella trichopoda] Q7... 91 4e-17 AFU97044.1 AtpI, partial (chloroplast) [Rhizophora mangle] 91 4e-17 YP_009130827.1 ATP synthase CF0 subunit IV (chloroplast) [Gossyp... 90 4e-17 >AFN85350.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Aerangis hyaloides] Length = 140 Score = 90.1 bits (222), Expect = 4e-18 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 82 RLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 140 >AFN85358.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Eria corneri] Length = 142 Score = 90.1 bits (222), Expect = 5e-18 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 84 RLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 142 >AFN85351.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Bletilla formosana] AFN85352.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Calanthe alismifolia] AFN85353.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Calanthe discolor] AFN85354.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Calanthe rosea] AFN85355.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Calanthe sylvatica] AFN85356.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Cymbidium aloifolium] AFN85359.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Phaius takeoi] AFN85360.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Spathoglottis plicata] Length = 142 Score = 90.1 bits (222), Expect = 5e-18 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 84 RLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 142 >AFN85349.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Acampe rigida] AFN85357.1 ATP synthase CF0 subunit IV, partial (chloroplast) [Dendrobium equitans] Length = 142 Score = 90.1 bits (222), Expect = 5e-18 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 84 RLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 142 >ALI89392.1 AtpI, partial (chloroplast) [Calatola mollis] Length = 143 Score = 90.1 bits (222), Expect = 5e-18 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 85 RLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 143 >BAU22214.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22216.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22218.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22222.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22225.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22227.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22230.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] Length = 64 Score = 87.4 bits (215), Expect = 5e-18 Identities = 45/59 (76%), Positives = 47/59 (79%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V ++PIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 6 RLFGNILADELVVVVLVSLVPLVIPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 64 >BAU22215.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22217.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22219.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22220.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22221.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22223.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22224.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22226.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22228.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] BAU22229.1 ATP synthase CF0 A subunit, partial (chloroplast) [Toxicodendron succedaneum] Length = 65 Score = 87.4 bits (215), Expect = 5e-18 Identities = 45/59 (76%), Positives = 47/59 (79%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V ++PIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 7 RLFGNILADELVVVVLVSLVPLVIPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 65 >AGL75838.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies grandis] Length = 88 Score = 87.8 bits (216), Expect = 7e-18 Identities = 46/59 (77%), Positives = 47/59 (79%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V +VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 30 RLFGNILADELVVAVPVSPVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 88 >KQK91810.1 hypothetical protein SETIT_038243mg [Setaria italica] Length = 90 Score = 87.8 bits (216), Expect = 8e-18 Identities = 46/59 (77%), Positives = 47/59 (79%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V +VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 32 RLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 90 >AGL75841.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies durangensis] Length = 121 Score = 87.8 bits (216), Expect = 2e-17 Identities = 46/59 (77%), Positives = 47/59 (79%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V +VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 63 RLFGNILADELVVAVPVSPVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 121 >AGL75820.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies lasiocarpa] AGL75821.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies lasiocarpa] AGL75822.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies balsamea] AGL75823.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies balsamea] AGL75824.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies fraseri] AGL75825.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies balsamea var. phanerolepis] Length = 121 Score = 87.8 bits (216), Expect = 2e-17 Identities = 46/59 (77%), Positives = 47/59 (79%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V +VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 63 RLFGNILADELVVAVPVSPVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 121 >AGL75795.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sibirica] AGL75796.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sibirica] AGL75797.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sibirica subsp. semenovii] AGL75798.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sibirica subsp. semenovii] AGL75799.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies nephrolepis] AGL75800.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies nephrolepis] AGL75801.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sachalinensis] AGL75802.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sachalinensis] AGL75803.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sachalinensis var. gracilis] AGL75804.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies sachalinensis var. gracilis] AGL75805.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies koreana] AGL75806.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies veitchii] AGL75807.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies veitchii] AGL75808.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies chensiensis] AGL75809.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies holophylla] AGL75810.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies homolepis] AGL75811.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies homolepis] AGL75812.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies firma] AGL75813.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies firma] AGL75814.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies spectabilis] AGL75815.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies densa] AGL75816.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies squamata] AGL75817.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies recurvata] AGL75818.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies delavayi] AGL75819.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies forrestii] AGL75826.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies alba] AGL75827.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies alba] AGL75828.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies nordmanniana] AGL75829.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies cephalonica] AGL75830.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies numidica] AGL75831.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies cilicica] AGL75832.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies pinsapo] AGL75833.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies pinsapo] AGL75834.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies nordmanniana subsp. equi-trojani] AGL75835.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies magnifica] AGL75836.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies magnifica] AGL75837.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies grandis] AGL75839.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies concolor] AGL75840.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies concolor] AGL75842.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies religiosa] AGL75843.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies guatemalensis] AGL75844.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies vejarii] AGL75845.1 ATP synthase CF0 A subunit, partial (chloroplast) [Abies bracteata] Length = 121 Score = 87.8 bits (216), Expect = 2e-17 Identities = 46/59 (77%), Positives = 47/59 (79%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V +VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 63 RLFGNILADELVVAVPVSPVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 121 >ANP26093.1 ATP synthase CF0 subunit IV (plastid) [Tacca chantrieri] Length = 247 Score = 90.5 bits (223), Expect = 4e-17 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 189 RLFGNILADELVVVVLVSLVPSLVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 247 >YP_001294340.1 ATP synthase CF0 A subunit [Dioscorea elephantipes] A6MMJ5.1 RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV ABR01418.1 ATP synthase CF0 subunit IV (chloroplast) [Dioscorea elephantipes] Length = 247 Score = 90.5 bits (223), Expect = 4e-17 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 189 RLFGNILADELVVVVLVSLVPSLVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 247 >AKJ77542.1 ATP synthase CF0 A subunit (chloroplast) [Dioscorea nipponica] Length = 247 Score = 90.5 bits (223), Expect = 4e-17 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 189 RLFGNILADELVVVVLVSLVPSLVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 247 >YP_009139089.1 ATP synthase CF0 subunit IV (chloroplast) [Dioscorea zingiberensis] AKF33639.1 ATP synthase CF0 subunit IV (chloroplast) [Dioscorea zingiberensis] Length = 247 Score = 90.5 bits (223), Expect = 4e-17 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 189 RLFGNILADELVVVVLVSLVPSLVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 247 >YP_009033873.1 ATP synthase CF0 A subunit (plastid) [Dioscorea rotundata] AHZ18119.1 ATP synthase CF0 A subunit (plastid) [Dioscorea rotundata] Length = 247 Score = 90.5 bits (223), Expect = 4e-17 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 189 RLFGNILADELVVVVLVSLVPSLVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 247 >NP_904087.1 ATP synthase CF0 A subunit [Amborella trichopoda] Q70XU8.1 RecName: Full=ATP synthase subunit a, chloroplastic; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit IV CAD56283.1 ATPase a subunit (chloroplast) [Amborella trichopoda] Length = 248 Score = 90.5 bits (223), Expect = 4e-17 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 190 RLFGNILADELVVVVLVSLVPSLVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 248 >AFU97044.1 AtpI, partial (chloroplast) [Rhizophora mangle] Length = 256 Score = 90.5 bits (223), Expect = 4e-17 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 198 RLFGNILADELVVVVLVSLVPSLVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 256 >YP_009130827.1 ATP synthase CF0 subunit IV (chloroplast) [Gossypium turneri] AFH57565.1 ATP synthase CF0 subunit IV (chloroplast) [Gossypium turneri] Length = 241 Score = 90.1 bits (222), Expect = 4e-17 Identities = 47/59 (79%), Positives = 48/59 (81%) Frame = -1 Query: 524 RLFGNILTDEXXXXXXXXXVTSMVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 348 RLFGNIL DE V S+VPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH Sbjct: 183 RLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESMEGHH 241