BLASTX nr result
ID: Panax25_contig00015100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00015100 (499 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK54927.1 uncharacterized protein A4U43_UnF9600 [Asparagus offi... 130 1e-33 XP_020086127.1 mitochondrial thiamine pyrophosphate carrier-like... 127 2e-33 XP_020086126.1 mitochondrial thiamine pyrophosphate carrier-like... 127 2e-33 OAY83584.1 Mitochondrial thiamine pyrophosphate carrier, partial... 130 3e-33 XP_002272682.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 129 3e-33 JAT60829.1 Mitochondrial thiamine pyrophosphate carrier, partial... 127 2e-32 XP_011090946.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 126 3e-32 XP_011090945.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 126 4e-32 XP_008810781.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 125 7e-32 CDP19540.1 unnamed protein product [Coffea canephora] 125 1e-31 KNA24734.1 hypothetical protein SOVF_013170 [Spinacia oleracea] 125 1e-31 XP_008223169.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 124 1e-31 XP_010921796.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 124 2e-31 XP_010921795.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 124 2e-31 XP_011627444.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 124 2e-31 XP_011627443.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 124 3e-31 XP_015959736.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 122 4e-31 XP_017220695.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 123 4e-31 XP_015959735.1 PREDICTED: mitochondrial thiamine pyrophosphate c... 122 4e-31 ERN16985.1 hypothetical protein AMTR_s00057p00207420 [Amborella ... 124 6e-31 >ONK54927.1 uncharacterized protein A4U43_UnF9600 [Asparagus officinalis] Length = 331 Score = 130 bits (326), Expect = 1e-33 Identities = 64/72 (88%), Positives = 68/72 (94%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRAFIDA AGAISG ISRTVTSPLDVIKIRFQVQLEPT+SW LL KD++RPSK Sbjct: 1 MEEPGQLKRAFIDATAGAISGGISRTVTSPLDVIKIRFQVQLEPTTSWPLLQKDLYRPSK 60 Query: 210 YTGMLQATKDIF 245 YTG+LQATKDIF Sbjct: 61 YTGILQATKDIF 72 >XP_020086127.1 mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Ananas comosus] Length = 266 Score = 127 bits (320), Expect = 2e-33 Identities = 61/72 (84%), Positives = 70/72 (97%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRAFID++AGA++G ISRTVTSPLDVIKIRFQVQLEPTSSWALL +D++RPSK Sbjct: 1 MEEPGQLKRAFIDSLAGALAGGISRTVTSPLDVIKIRFQVQLEPTSSWALLQRDMYRPSK 60 Query: 210 YTGMLQATKDIF 245 YTG+LQA+KDIF Sbjct: 61 YTGILQASKDIF 72 >XP_020086126.1 mitochondrial thiamine pyrophosphate carrier-like isoform X1 [Ananas comosus] Length = 267 Score = 127 bits (320), Expect = 2e-33 Identities = 61/72 (84%), Positives = 70/72 (97%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRAFID++AGA++G ISRTVTSPLDVIKIRFQVQLEPTSSWALL +D++RPSK Sbjct: 1 MEEPGQLKRAFIDSLAGALAGGISRTVTSPLDVIKIRFQVQLEPTSSWALLQRDMYRPSK 60 Query: 210 YTGMLQATKDIF 245 YTG+LQA+KDIF Sbjct: 61 YTGILQASKDIF 72 >OAY83584.1 Mitochondrial thiamine pyrophosphate carrier, partial [Ananas comosus] Length = 384 Score = 130 bits (326), Expect = 3e-33 Identities = 62/73 (84%), Positives = 71/73 (97%) Frame = +3 Query: 27 GMEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPS 206 GMEEPGQLKRAFID++AGA++G ISRTVTSPLDVIKIRFQVQLEPTSSWALL +D++RPS Sbjct: 53 GMEEPGQLKRAFIDSLAGALAGGISRTVTSPLDVIKIRFQVQLEPTSSWALLQRDMYRPS 112 Query: 207 KYTGMLQATKDIF 245 KYTG+LQA+KDIF Sbjct: 113 KYTGILQASKDIF 125 >XP_002272682.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] XP_010649727.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] XP_010649728.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] XP_010649729.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] XP_010649730.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] CBI26066.3 unnamed protein product, partial [Vitis vinifera] Length = 330 Score = 129 bits (323), Expect = 3e-33 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRAFIDA AGAI+G ISRTVTSPLDVIKIRFQVQLEPT+SWALL +DVH SK Sbjct: 1 MEEPGQLKRAFIDAAAGAIAGGISRTVTSPLDVIKIRFQVQLEPTTSWALLRRDVHGQSK 60 Query: 210 YTGMLQATKDIF 245 YTGMLQATKDIF Sbjct: 61 YTGMLQATKDIF 72 >JAT60829.1 Mitochondrial thiamine pyrophosphate carrier, partial [Anthurium amnicola] Length = 341 Score = 127 bits (318), Expect = 2e-32 Identities = 62/72 (86%), Positives = 67/72 (93%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRA ID AGAI+G ISRTVTSPLDVIKIRFQVQLEPTSSWALL +D++RPSK Sbjct: 11 MEEPGQLKRALIDTTAGAIAGGISRTVTSPLDVIKIRFQVQLEPTSSWALLQRDLYRPSK 70 Query: 210 YTGMLQATKDIF 245 YTG+LQATKDIF Sbjct: 71 YTGVLQATKDIF 82 >XP_011090946.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Sesamum indicum] XP_011090947.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Sesamum indicum] Length = 329 Score = 126 bits (317), Expect = 3e-32 Identities = 62/72 (86%), Positives = 67/72 (93%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQ+KRA IDA AGAISGAISRTVTSPLDVIKIRFQVQLEPT+ WALL +DV+ P+K Sbjct: 1 MEEPGQIKRALIDASAGAISGAISRTVTSPLDVIKIRFQVQLEPTTQWALLRRDVYNPAK 60 Query: 210 YTGMLQATKDIF 245 YTGMLQATKDIF Sbjct: 61 YTGMLQATKDIF 72 >XP_011090945.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X1 [Sesamum indicum] Length = 359 Score = 126 bits (317), Expect = 4e-32 Identities = 62/72 (86%), Positives = 67/72 (93%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQ+KRA IDA AGAISGAISRTVTSPLDVIKIRFQVQLEPT+ WALL +DV+ P+K Sbjct: 31 MEEPGQIKRALIDASAGAISGAISRTVTSPLDVIKIRFQVQLEPTTQWALLRRDVYNPAK 90 Query: 210 YTGMLQATKDIF 245 YTGMLQATKDIF Sbjct: 91 YTGMLQATKDIF 102 >XP_008810781.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Phoenix dactylifera] Length = 331 Score = 125 bits (314), Expect = 7e-32 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRA ID +AGAISG ISRTVTSPLDVIKIRFQVQLEPTS WALL ++++RPSK Sbjct: 1 MEEPGQLKRALIDCLAGAISGGISRTVTSPLDVIKIRFQVQLEPTSQWALLQRELYRPSK 60 Query: 210 YTGMLQATKDIF 245 YTG+LQATKDIF Sbjct: 61 YTGILQATKDIF 72 >CDP19540.1 unnamed protein product [Coffea canephora] Length = 329 Score = 125 bits (313), Expect = 1e-31 Identities = 62/72 (86%), Positives = 65/72 (90%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRA IDA AGAISGA+SRTVTSPLDVIKIRFQVQLEPT+ WALL KD +RPSK Sbjct: 1 MEEPGQLKRALIDATAGAISGAVSRTVTSPLDVIKIRFQVQLEPTAQWALLRKDSYRPSK 60 Query: 210 YTGMLQATKDIF 245 YT M QATKDIF Sbjct: 61 YTSMWQATKDIF 72 >KNA24734.1 hypothetical protein SOVF_013170 [Spinacia oleracea] Length = 332 Score = 125 bits (313), Expect = 1e-31 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEP QLKRA IDA AGAISGAISR+VTSPLDVIKIRFQVQLEPT+SWA+LHK+++RPSK Sbjct: 1 MEEPSQLKRALIDASAGAISGAISRSVTSPLDVIKIRFQVQLEPTTSWAMLHKNIYRPSK 60 Query: 210 YTGMLQATKDIF 245 YTGM QA KDIF Sbjct: 61 YTGMSQAAKDIF 72 >XP_008223169.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier 1-like [Prunus mume] Length = 331 Score = 124 bits (312), Expect = 1e-31 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEE GQLKRAFIDA AG I+G ISRTVTSPLDVIKIRFQVQLEPT+SWALLHK++ +PSK Sbjct: 1 MEETGQLKRAFIDATAGLIAGGISRTVTSPLDVIKIRFQVQLEPTTSWALLHKNLSQPSK 60 Query: 210 YTGMLQATKDIF 245 YTGMLQAT+DIF Sbjct: 61 YTGMLQATRDIF 72 >XP_010921796.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Elaeis guineensis] Length = 318 Score = 124 bits (311), Expect = 2e-31 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRA IDA+AGAISG ISRTVTSPLDVIKIRFQVQLEPTS WALL ++++ PSK Sbjct: 1 MEEPGQLKRALIDALAGAISGGISRTVTSPLDVIKIRFQVQLEPTSQWALLQRELYGPSK 60 Query: 210 YTGMLQATKDIF 245 YTG+LQATKDIF Sbjct: 61 YTGILQATKDIF 72 >XP_010921795.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X1 [Elaeis guineensis] Length = 331 Score = 124 bits (311), Expect = 2e-31 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRA IDA+AGAISG ISRTVTSPLDVIKIRFQVQLEPTS WALL ++++ PSK Sbjct: 1 MEEPGQLKRALIDALAGAISGGISRTVTSPLDVIKIRFQVQLEPTSQWALLQRELYGPSK 60 Query: 210 YTGMLQATKDIF 245 YTG+LQATKDIF Sbjct: 61 YTGILQATKDIF 72 >XP_011627444.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X2 [Amborella trichopoda] Length = 324 Score = 124 bits (310), Expect = 2e-31 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRAFIDA AGAI+G ISRT+TSPLDVIKIRFQVQLEPTSSWAL H V+ PSK Sbjct: 1 MEEPGQLKRAFIDATAGAIAGGISRTITSPLDVIKIRFQVQLEPTSSWALPHGGVYGPSK 60 Query: 210 YTGMLQATKDIF 245 YTG+LQATKDI+ Sbjct: 61 YTGILQATKDIY 72 >XP_011627443.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X1 [Amborella trichopoda] Length = 331 Score = 124 bits (310), Expect = 3e-31 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRAFIDA AGAI+G ISRT+TSPLDVIKIRFQVQLEPTSSWAL H V+ PSK Sbjct: 1 MEEPGQLKRAFIDATAGAIAGGISRTITSPLDVIKIRFQVQLEPTSSWALPHGGVYGPSK 60 Query: 210 YTGMLQATKDIF 245 YTG+LQATKDI+ Sbjct: 61 YTGILQATKDIY 72 >XP_015959736.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X3 [Arachis duranensis] XP_016197966.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X3 [Arachis ipaensis] Length = 261 Score = 122 bits (305), Expect = 4e-31 Identities = 61/71 (85%), Positives = 65/71 (91%) Frame = +3 Query: 33 EEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSKY 212 EEP QLKRA ID+ AGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALL K++ PSKY Sbjct: 6 EEPSQLKRALIDSSAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLRKEISAPSKY 65 Query: 213 TGMLQATKDIF 245 TGMLQA+KDIF Sbjct: 66 TGMLQASKDIF 76 >XP_017220695.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Daucus carota subsp. sativus] XP_017220696.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Daucus carota subsp. sativus] Length = 329 Score = 123 bits (309), Expect = 4e-31 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLK+AFI+A AGA SGA+SRTVTSPLDVIKIRFQVQLEPTSSWALL K +H SK Sbjct: 1 MEEPGQLKQAFINATAGAASGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKQLHGTSK 60 Query: 210 YTGMLQATKDIF 245 YTGMLQATKDI+ Sbjct: 61 YTGMLQATKDIY 72 >XP_015959735.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Arachis duranensis] XP_016197965.1 PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Arachis ipaensis] Length = 265 Score = 122 bits (305), Expect = 4e-31 Identities = 61/71 (85%), Positives = 65/71 (91%) Frame = +3 Query: 33 EEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSKY 212 EEP QLKRA ID+ AGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALL K++ PSKY Sbjct: 6 EEPSQLKRALIDSSAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLRKEISAPSKY 65 Query: 213 TGMLQATKDIF 245 TGMLQA+KDIF Sbjct: 66 TGMLQASKDIF 76 >ERN16985.1 hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] Length = 369 Score = 124 bits (310), Expect = 6e-31 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = +3 Query: 30 MEEPGQLKRAFIDAVAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALLHKDVHRPSK 209 MEEPGQLKRAFIDA AGAI+G ISRT+TSPLDVIKIRFQVQLEPTSSWAL H V+ PSK Sbjct: 39 MEEPGQLKRAFIDATAGAIAGGISRTITSPLDVIKIRFQVQLEPTSSWALPHGGVYGPSK 98 Query: 210 YTGMLQATKDIF 245 YTG+LQATKDI+ Sbjct: 99 YTGILQATKDIY 110