BLASTX nr result
ID: Panax25_contig00014322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00014322 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017218459.1 PREDICTED: aspartic proteinase-like protein 2 [Da... 102 1e-22 XP_018851666.1 PREDICTED: aspartic proteinase-like protein 2 iso... 94 9e-20 XP_018851665.1 PREDICTED: aspartic proteinase-like protein 2 iso... 94 9e-20 KZV54413.1 aspartic protein-like protein 2-like [Dorcoceras hygr... 92 3e-19 EYU43423.1 hypothetical protein MIMGU_mgv1a0027552mg, partial [E... 91 8e-19 XP_012837921.1 PREDICTED: aspartic proteinase-like protein 2 [Er... 91 8e-19 XP_012830062.1 PREDICTED: aspartic proteinase-like protein 2 [Er... 91 8e-19 OMO56552.1 Natural resistance-associated macrophage protein [Cor... 91 1e-18 XP_019187431.1 PREDICTED: aspartic proteinase-like protein 2 [Ip... 90 2e-18 XP_019233855.1 PREDICTED: aspartic proteinase-like protein 2 iso... 89 4e-18 XP_019233853.1 PREDICTED: aspartic proteinase-like protein 2 iso... 89 4e-18 CDP15549.1 unnamed protein product [Coffea canephora] 89 4e-18 XP_009603173.1 PREDICTED: aspartic proteinase-like protein 2 iso... 89 5e-18 XP_009603172.1 PREDICTED: aspartic proteinase-like protein 2 iso... 89 5e-18 OMP01877.1 Peptidase A1 [Corchorus olitorius] 88 7e-18 XP_011016146.1 PREDICTED: aspartic proteinase-like protein 2 [Po... 88 7e-18 XP_011015887.1 PREDICTED: aspartic proteinase-like protein 2 [Po... 88 7e-18 XP_002306494.2 hypothetical protein POPTR_0005s18810g [Populus t... 88 7e-18 XP_016468317.1 PREDICTED: uncharacterized protein LOC107790867 [... 86 7e-18 XP_017239740.1 PREDICTED: aspartic proteinase-like protein 2 [Da... 88 1e-17 >XP_017218459.1 PREDICTED: aspartic proteinase-like protein 2 [Daucus carota subsp. sativus] KZM88695.1 hypothetical protein DCAR_025770 [Daucus carota subsp. sativus] Length = 646 Score = 102 bits (253), Expect = 1e-22 Identities = 47/52 (90%), Positives = 47/52 (90%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTG PPP PSA R NST Sbjct: 412 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGAPPPEPSAGKRPNST 463 >XP_018851666.1 PREDICTED: aspartic proteinase-like protein 2 isoform X2 [Juglans regia] Length = 634 Score = 93.6 bits (231), Expect = 9e-20 Identities = 45/71 (63%), Positives = 48/71 (67%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNSTXXXXXXXX 204 GGIVVRNT VTYDREH KIGFWKTNCSELWERL+ +G PPP PSA + NST Sbjct: 400 GGIVVRNTLVTYDREHSKIGFWKTNCSELWERLHKSGAPPPMPSAPNGKNSTAEIPPTLA 459 Query: 203 XXXPSHYVPSG 171 HYV G Sbjct: 460 PTKAPHYVLPG 470 >XP_018851665.1 PREDICTED: aspartic proteinase-like protein 2 isoform X1 [Juglans regia] Length = 637 Score = 93.6 bits (231), Expect = 9e-20 Identities = 45/71 (63%), Positives = 48/71 (67%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNSTXXXXXXXX 204 GGIVVRNT VTYDREH KIGFWKTNCSELWERL+ +G PPP PSA + NST Sbjct: 403 GGIVVRNTLVTYDREHSKIGFWKTNCSELWERLHKSGAPPPMPSAPNGKNSTAEIPPTLA 462 Query: 203 XXXPSHYVPSG 171 HYV G Sbjct: 463 PTKAPHYVLPG 473 >KZV54413.1 aspartic protein-like protein 2-like [Dorcoceras hygrometricum] Length = 1098 Score = 92.4 bits (228), Expect = 3e-19 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGI+VRNT VTYDREHE+IGFWKTNCSELWERLN++ PPP PS L++ NS+ Sbjct: 864 GGIIVRNTLVTYDREHERIGFWKTNCSELWERLNLSSAPPPLPSGLNQTNSS 915 Score = 80.5 bits (197), Expect = 4e-15 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -1 Query: 380 GIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GI+ RNT VTYDREHE+IGFWKTNCSELWE+ V+ PPP P L + NST Sbjct: 392 GIIFRNTLVTYDREHERIGFWKTNCSELWEKPKVSVAPPPLPLGLHQTNST 442 >EYU43423.1 hypothetical protein MIMGU_mgv1a0027552mg, partial [Erythranthe guttata] Length = 516 Score = 90.9 bits (224), Expect = 8e-19 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGIVVRNT VTYDREHEKIGFWKTNCS+LWERL+++ PPP PS D+ NST Sbjct: 279 GGIVVRNTLVTYDREHEKIGFWKTNCSQLWERLHLSPAPPPLPSGTDKDNST 330 >XP_012837921.1 PREDICTED: aspartic proteinase-like protein 2 [Erythranthe guttata] EYU37054.1 hypothetical protein MIMGU_mgv1a003205mg [Erythranthe guttata] Length = 600 Score = 90.9 bits (224), Expect = 8e-19 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGIVVRNT VTYDREHEKIGFWKTNCS+LWERL+++ PPP PS D+ NST Sbjct: 361 GGIVVRNTLVTYDREHEKIGFWKTNCSQLWERLHLSPAPPPLPSGTDKDNST 412 >XP_012830062.1 PREDICTED: aspartic proteinase-like protein 2 [Erythranthe guttata] Length = 652 Score = 90.9 bits (224), Expect = 8e-19 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGIVVRNT VTYDREHEKIGFWKTNCS+LWERL+++ PPP PS D+ NST Sbjct: 406 GGIVVRNTLVTYDREHEKIGFWKTNCSQLWERLHLSPAPPPLPSGTDKDNST 457 >OMO56552.1 Natural resistance-associated macrophage protein [Corchorus capsularis] Length = 1778 Score = 90.5 bits (223), Expect = 1e-18 Identities = 41/71 (57%), Positives = 47/71 (66%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNSTXXXXXXXX 204 GGI+VRNT VTYDREH KIGFWKTNCSELWERL++TG P P PS+ + N T Sbjct: 1543 GGIIVRNTLVTYDREHAKIGFWKTNCSELWERLHITGAPSPSPSSNGKDNPTVESQPTSA 1602 Query: 203 XXXPSHYVPSG 171 +HY G Sbjct: 1603 PDGSTHYALPG 1613 >XP_019187431.1 PREDICTED: aspartic proteinase-like protein 2 [Ipomoea nil] Length = 661 Score = 90.1 bits (222), Expect = 2e-18 Identities = 40/52 (76%), Positives = 42/52 (80%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGIVVRNT VTYDREHEKIGFWKTNCSELW+RL V+ P P PS D NST Sbjct: 425 GGIVVRNTLVTYDREHEKIGFWKTNCSELWDRLGVSNAPSPSPSKSDNKNST 476 >XP_019233855.1 PREDICTED: aspartic proteinase-like protein 2 isoform X2 [Nicotiana attenuata] Length = 596 Score = 89.0 bits (219), Expect = 4e-18 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGIVVRNT VTYDRE+E+IGFWKTNCSELW+RLN++ PPP PS LD NS+ Sbjct: 362 GGIVVRNTLVTYDRENERIGFWKTNCSELWDRLNLSPSPPPLPSVLDNTNSS 413 >XP_019233853.1 PREDICTED: aspartic proteinase-like protein 2 isoform X1 [Nicotiana attenuata] OIT27116.1 aspartic proteinase-like protein 2 [Nicotiana attenuata] Length = 651 Score = 89.0 bits (219), Expect = 4e-18 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGIVVRNT VTYDRE+E+IGFWKTNCSELW+RLN++ PPP PS LD NS+ Sbjct: 417 GGIVVRNTLVTYDRENERIGFWKTNCSELWDRLNLSPSPPPLPSVLDNTNSS 468 >CDP15549.1 unnamed protein product [Coffea canephora] Length = 661 Score = 89.0 bits (219), Expect = 4e-18 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGI+VRNT VTYDREHEKIGFWKTNCS LWERL+++ PPP PS L+ N T Sbjct: 430 GGIIVRNTLVTYDREHEKIGFWKTNCSHLWERLHISNAPPPLPSELNNTNFT 481 >XP_009603173.1 PREDICTED: aspartic proteinase-like protein 2 isoform X2 [Nicotiana tomentosiformis] XP_016502286.1 PREDICTED: aspartic proteinase-like protein 2 isoform X2 [Nicotiana tabacum] Length = 637 Score = 88.6 bits (218), Expect = 5e-18 Identities = 44/84 (52%), Positives = 54/84 (64%), Gaps = 1/84 (1%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST-XXXXXXX 207 GGIVVRNT VTYDRE+E+IGFWKTNCSE+W+RLN++ PPP PS LD NS+ Sbjct: 414 GGIVVRNTLVTYDRENERIGFWKTNCSEIWDRLNLSPSPPPLPSGLDNTNSSANLTPALA 473 Query: 206 XXXXPSHYVPSGIVMRHICIVLLL 135 P HY P I + + + L Sbjct: 474 PSLPPEHYAPGKIKIGFVSFYMSL 497 >XP_009603172.1 PREDICTED: aspartic proteinase-like protein 2 isoform X1 [Nicotiana tomentosiformis] XP_016502285.1 PREDICTED: aspartic proteinase-like protein 2 isoform X1 [Nicotiana tabacum] Length = 648 Score = 88.6 bits (218), Expect = 5e-18 Identities = 44/84 (52%), Positives = 54/84 (64%), Gaps = 1/84 (1%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST-XXXXXXX 207 GGIVVRNT VTYDRE+E+IGFWKTNCSE+W+RLN++ PPP PS LD NS+ Sbjct: 414 GGIVVRNTLVTYDRENERIGFWKTNCSEIWDRLNLSPSPPPLPSGLDNTNSSANLTPALA 473 Query: 206 XXXXPSHYVPSGIVMRHICIVLLL 135 P HY P I + + + L Sbjct: 474 PSLPPEHYAPGKIKIGFVSFYMSL 497 >OMP01877.1 Peptidase A1 [Corchorus olitorius] Length = 536 Score = 88.2 bits (217), Expect = 7e-18 Identities = 40/71 (56%), Positives = 46/71 (64%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNSTXXXXXXXX 204 GGI+VRNT VTYDREH KIGFWKTNCSELWERL++T P P PS+ + N T Sbjct: 301 GGIIVRNTLVTYDREHSKIGFWKTNCSELWERLHITDAPSPSPSSNGKDNPTVESQPTSA 360 Query: 203 XXXPSHYVPSG 171 +HY G Sbjct: 361 PDGSTHYALPG 371 >XP_011016146.1 PREDICTED: aspartic proteinase-like protein 2 [Populus euphratica] Length = 641 Score = 88.2 bits (217), Expect = 7e-18 Identities = 41/67 (61%), Positives = 44/67 (65%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNSTXXXXXXXX 204 GGIVVRNT V YDRE+ KIGFWKTNCSELWERLNV G PPP PS+ + NS Sbjct: 407 GGIVVRNTLVLYDRENSKIGFWKTNCSELWERLNVDGAPPPAPSSSNGNNSNTEMPPSMA 466 Query: 203 XXXPSHY 183 HY Sbjct: 467 PSDQKHY 473 >XP_011015887.1 PREDICTED: aspartic proteinase-like protein 2 [Populus euphratica] Length = 641 Score = 88.2 bits (217), Expect = 7e-18 Identities = 41/67 (61%), Positives = 44/67 (65%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNSTXXXXXXXX 204 GGIVVRNT V YDRE+ KIGFWKTNCSELWERLNV G PPP PS+ + NS Sbjct: 407 GGIVVRNTLVLYDRENSKIGFWKTNCSELWERLNVDGAPPPAPSSSNGNNSNTEMPPSMA 466 Query: 203 XXXPSHY 183 HY Sbjct: 467 PSDQKHY 473 >XP_002306494.2 hypothetical protein POPTR_0005s18810g [Populus trichocarpa] EEE93490.2 hypothetical protein POPTR_0005s18810g [Populus trichocarpa] Length = 641 Score = 88.2 bits (217), Expect = 7e-18 Identities = 41/67 (61%), Positives = 44/67 (65%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNSTXXXXXXXX 204 GGIVVRNT V YDRE+ KIGFWKTNCSELWERLNV G PPP PS+ + NS Sbjct: 407 GGIVVRNTLVLYDRENSKIGFWKTNCSELWERLNVDGAPPPAPSSSNGNNSNTEMPPSVA 466 Query: 203 XXXPSHY 183 HY Sbjct: 467 PSDQKHY 473 >XP_016468317.1 PREDICTED: uncharacterized protein LOC107790867 [Nicotiana tabacum] Length = 261 Score = 85.9 bits (211), Expect = 7e-18 Identities = 39/52 (75%), Positives = 41/52 (78%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALDRLNST 228 GGI+VRNT VTYDREHE IGFWKTNCSELW RLN + PP PS LD NST Sbjct: 26 GGIIVRNTLVTYDREHETIGFWKTNCSELWGRLNSSPPPPALPSGLDNTNST 77 >XP_017239740.1 PREDICTED: aspartic proteinase-like protein 2 [Daucus carota subsp. sativus] KZN02088.1 hypothetical protein DCAR_010842 [Daucus carota subsp. sativus] Length = 627 Score = 87.8 bits (216), Expect = 1e-17 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 383 GGIVVRNTFVTYDREHEKIGFWKTNCSELWERLNVTGVPPPGPSALD 243 G IVVRNTFVTYDRE+++IGFWKTNCSE+WERLN TG P PGPS L+ Sbjct: 393 GAIVVRNTFVTYDRENQQIGFWKTNCSEVWERLNATGAPTPGPSTLE 439