BLASTX nr result
ID: Panax25_contig00014006
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00014006 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247281.1 PREDICTED: two-component response regulator-like ... 54 6e-06 >XP_017247281.1 PREDICTED: two-component response regulator-like APRR3 [Daucus carota subsp. sativus] XP_017247282.1 PREDICTED: two-component response regulator-like APRR3 [Daucus carota subsp. sativus] KZM97383.1 hypothetical protein DCAR_015255 [Daucus carota subsp. sativus] Length = 717 Score = 53.9 bits (128), Expect = 6e-06 Identities = 38/98 (38%), Positives = 44/98 (44%) Frame = +3 Query: 6 SLVNAHSCSAFQSVKNSHTPYNPPEIQDKADPSTAQARTTXXXXXXXXXXXXXXXXXXXX 185 SLVNAH +FQ K+S PE+Q AD AQ RT Sbjct: 495 SLVNAHP--SFQLFKDSDNSSMKPELQGLADTGKAQERTAHRQVQVQHHHHHYHHHHHHV 552 Query: 186 XXXXXXXXLSDHNNLSLKDKAASASHFGPSNMLTAPSE 299 L+DHN+LS K A SASHFG SN+ AP E Sbjct: 553 HDMNEKEQLTDHNSLSFKSNA-SASHFGSSNVANAPIE 589