BLASTX nr result
ID: Panax25_contig00013729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00013729 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017231050.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 96 3e-21 CDP19077.1 unnamed protein product [Coffea canephora] 92 6e-20 XP_016492318.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 86 2e-19 XP_006364258.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 91 2e-19 XP_010257039.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 89 7e-19 XP_004244790.2 PREDICTED: Golgi to ER traffic protein 4 homolog ... 89 1e-18 XP_019254463.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 88 2e-18 XP_015083181.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 88 2e-18 XP_009757994.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 88 2e-18 XP_010669680.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 87 5e-18 XP_018840945.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 87 5e-18 XP_009615185.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 86 9e-18 XP_017616932.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 86 1e-17 KJB78900.1 hypothetical protein B456_013G025000 [Gossypium raimo... 85 2e-17 XP_011469680.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 85 2e-17 XP_016537545.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 85 2e-17 XP_016703315.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 85 2e-17 XP_012464573.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 85 2e-17 XP_016508657.1 PREDICTED: Golgi to ER traffic protein 4 homolog ... 81 2e-17 KJB78898.1 hypothetical protein B456_013G025000 [Gossypium raimo... 85 2e-17 >XP_017231050.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Daucus carota subsp. sativus] KZN05627.1 hypothetical protein DCAR_006464 [Daucus carota subsp. sativus] Length = 325 Score = 95.5 bits (236), Expect = 3e-21 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGDGM 197 N LRQ YASS+DR+P NELLDVVAEKFYGVRR+NP+QDMFGDIFKMMGGD M Sbjct: 273 NRLRQTYASSLDRDPALNELLDVVAEKFYGVRRRNPMQDMFGDIFKMMGGDVM 325 >CDP19077.1 unnamed protein product [Coffea canephora] Length = 326 Score = 92.0 bits (227), Expect = 6e-20 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQNY SSI+REP F+ELLD +AEKFYGVRR+NPLQ MFGDIFKMMGG+ Sbjct: 276 NMLRQNYKSSIEREPVFHELLDEIAEKFYGVRRRNPLQGMFGDIFKMMGGE 326 >XP_016492318.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Nicotiana tabacum] Length = 122 Score = 86.3 bits (212), Expect = 2e-19 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQ+Y SSIDR+P NELLD +A+KFYGV+RKNPLQ MFGDIFKM+GG+ Sbjct: 72 NMLRQSYKSSIDRDPLLNELLDEIAKKFYGVQRKNPLQGMFGDIFKMIGGE 122 >XP_006364258.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Solanum tuberosum] Length = 328 Score = 90.5 bits (223), Expect = 2e-19 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQNY SSIDR+P FNELLD VA+KFYGV+RK+PLQ MFGDIFKMMGG+ Sbjct: 278 NMLRQNYKSSIDRDPLFNELLDEVAKKFYGVQRKSPLQGMFGDIFKMMGGE 328 >XP_010257039.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Nelumbo nucifera] Length = 332 Score = 89.4 bits (220), Expect = 7e-19 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 N+LRQNY SSI+REP ELLDV+AEKFYGVRR+ PLQ MFGDIFKMMGGD Sbjct: 279 NILRQNYKSSIEREPALEELLDVIAEKFYGVRRRTPLQGMFGDIFKMMGGD 329 >XP_004244790.2 PREDICTED: Golgi to ER traffic protein 4 homolog [Solanum lycopersicum] Length = 354 Score = 89.0 bits (219), Expect = 1e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQNY +SIDR+P FNELLD VA+KFYG++RK+PLQ MFGDIFKMMGG+ Sbjct: 304 NMLRQNYKTSIDRDPLFNELLDEVAKKFYGIQRKSPLQGMFGDIFKMMGGE 354 >XP_019254463.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Nicotiana attenuata] OIS97765.1 hypothetical protein A4A49_17728 [Nicotiana attenuata] Length = 326 Score = 87.8 bits (216), Expect = 2e-18 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQ+Y SSIDR+P NELLD +A+KFYGV+RKNPLQ MFGDIFKMMGG+ Sbjct: 276 NMLRQSYKSSIDRDPLLNELLDEIAKKFYGVQRKNPLQGMFGDIFKMMGGE 326 >XP_015083181.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Solanum pennellii] Length = 328 Score = 87.8 bits (216), Expect = 2e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQNY +SIDR+P FNELLD VA+KFYGV+RK+PLQ +FGDIFKMMGG+ Sbjct: 278 NMLRQNYKTSIDRDPLFNELLDEVAKKFYGVQRKSPLQGVFGDIFKMMGGE 328 >XP_009757994.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Nicotiana sylvestris] XP_016449496.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Nicotiana tabacum] Length = 328 Score = 87.8 bits (216), Expect = 2e-18 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQ+Y SSIDR+P NELLD +A+KFYGV+RKNPLQ MFGDIFKMMGG+ Sbjct: 278 NMLRQSYKSSIDRDPLLNELLDEIAKKFYGVQRKNPLQGMFGDIFKMMGGE 328 >XP_010669680.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Beta vulgaris subsp. vulgaris] KMT17714.1 hypothetical protein BVRB_2g036590 [Beta vulgaris subsp. vulgaris] Length = 322 Score = 87.0 bits (214), Expect = 5e-18 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 352 MLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMG 209 MLRQNY SSIDR+PTFNE LD +AE+FYGV+RKNP+Q MFGDIFKMMG Sbjct: 273 MLRQNYKSSIDRDPTFNEFLDEIAERFYGVQRKNPMQGMFGDIFKMMG 320 >XP_018840945.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Juglans regia] Length = 324 Score = 87.0 bits (214), Expect = 5e-18 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLR +Y +SI+REP FNELLD +AEKFYGVRR+NPLQ +FGDIFKMMGG+ Sbjct: 274 NMLRASYKTSIEREPAFNELLDEIAEKFYGVRRRNPLQGVFGDIFKMMGGE 324 >XP_009615185.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Nicotiana tomentosiformis] Length = 329 Score = 86.3 bits (212), Expect = 9e-18 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQ+Y SSIDR+P NELLD +A+KFYGV+RKNPLQ MFGDIFKM+GG+ Sbjct: 279 NMLRQSYKSSIDRDPLLNELLDEIAKKFYGVQRKNPLQGMFGDIFKMIGGE 329 >XP_017616932.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Gossypium arboreum] KHG18038.1 Golgi to ER traffic 4 [Gossypium arboreum] Length = 321 Score = 85.9 bits (211), Expect = 1e-17 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMM 212 NMLR NY SSIDREP FNELLD +AEKFYGV+R+NPLQ MFGD+FKMM Sbjct: 274 NMLRMNYKSSIDREPAFNELLDEIAEKFYGVQRRNPLQGMFGDLFKMM 321 >KJB78900.1 hypothetical protein B456_013G025000 [Gossypium raimondii] Length = 286 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMM 212 NMLR NY SSIDREP FNELLD +AEKFYGV+R+NPLQ MFGD+FKMM Sbjct: 239 NMLRVNYKSSIDREPAFNELLDEIAEKFYGVQRRNPLQGMFGDLFKMM 286 >XP_011469680.1 PREDICTED: Golgi to ER traffic protein 4 homolog isoform X2 [Fragaria vesca subsp. vesca] Length = 284 Score = 84.7 bits (208), Expect = 2e-17 Identities = 40/53 (75%), Positives = 47/53 (88%), Gaps = 2/53 (3%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQ--DMFGDIFKMMGGD 203 NMLR N+ SS+DREP+F+ELLD +AEKFYGVRR+NPLQ MFG+IFKMMGGD Sbjct: 232 NMLRSNFKSSLDREPSFHELLDEIAEKFYGVRRRNPLQGMGMFGEIFKMMGGD 284 >XP_016537545.1 PREDICTED: Golgi to ER traffic protein 4 homolog isoform X2 [Capsicum annuum] Length = 314 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQ+Y SS++R+P FNELLD VA+KFYGV+RKNPLQ MFGDIFKMMG + Sbjct: 264 NMLRQSYKSSMERDPLFNELLDEVAKKFYGVQRKNPLQGMFGDIFKMMGDE 314 >XP_016703315.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Gossypium hirsutum] Length = 321 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMM 212 NMLR NY SSIDREP FNELLD +AEKFYGV+R+NPLQ MFGD+FKMM Sbjct: 274 NMLRVNYKSSIDREPAFNELLDEIAEKFYGVQRRNPLQGMFGDLFKMM 321 >XP_012464573.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Gossypium raimondii] KJB78897.1 hypothetical protein B456_013G025000 [Gossypium raimondii] Length = 321 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMM 212 NMLR NY SSIDREP FNELLD +AEKFYGV+R+NPLQ MFGD+FKMM Sbjct: 274 NMLRVNYKSSIDREPAFNELLDEIAEKFYGVQRRNPLQGMFGDLFKMM 321 >XP_016508657.1 PREDICTED: Golgi to ER traffic protein 4 homolog [Nicotiana tabacum] Length = 121 Score = 80.9 bits (198), Expect = 2e-17 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMMGGD 203 NMLRQ Y SSIDRE TFNELLD +AEKFYGVRR+NPL+ + GD FKMMGG+ Sbjct: 72 NMLRQTYKSSIDRESTFNELLDEIAEKFYGVRRRNPLEGI-GDFFKMMGGE 121 >KJB78898.1 hypothetical protein B456_013G025000 [Gossypium raimondii] Length = 325 Score = 85.1 bits (209), Expect = 2e-17 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -1 Query: 355 NMLRQNYASSIDREPTFNELLDVVAEKFYGVRRKNPLQDMFGDIFKMM 212 NMLR NY SSIDREP FNELLD +AEKFYGV+R+NPLQ MFGD+FKMM Sbjct: 278 NMLRVNYKSSIDREPAFNELLDEIAEKFYGVQRRNPLQGMFGDLFKMM 325