BLASTX nr result
ID: Panax25_contig00013315
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00013315 (1068 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN05419.1 hypothetical protein DCAR_006256 [Daucus carota subsp... 60 5e-06 XP_017234771.1 PREDICTED: uncharacterized protein LOC108208758 i... 60 5e-06 >KZN05419.1 hypothetical protein DCAR_006256 [Daucus carota subsp. sativus] Length = 1777 Score = 59.7 bits (143), Expect = 5e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 24 QRCSSLHEHAHLILEVLLMRKQFQSASLIL 113 QRCSSLHEH HLILEVLLMRKQFQSASLIL Sbjct: 851 QRCSSLHEHPHLILEVLLMRKQFQSASLIL 880 >XP_017234771.1 PREDICTED: uncharacterized protein LOC108208758 isoform X1 [Daucus carota subsp. sativus] XP_017234772.1 PREDICTED: uncharacterized protein LOC108208758 isoform X2 [Daucus carota subsp. sativus] Length = 2487 Score = 59.7 bits (143), Expect = 5e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 24 QRCSSLHEHAHLILEVLLMRKQFQSASLIL 113 QRCSSLHEH HLILEVLLMRKQFQSASLIL Sbjct: 1609 QRCSSLHEHPHLILEVLLMRKQFQSASLIL 1638