BLASTX nr result
ID: Panax25_contig00013276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00013276 (542 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACT21542.1 spermidine synthase [Panax ginseng] 84 4e-16 AFH96952.1 spermidine synthase [Eleutherococcus senticosus] 80 2e-14 XP_002534321.1 PREDICTED: spermidine synthase 1 [Ricinus communi... 74 2e-12 OAY34570.1 hypothetical protein MANES_12G030300 [Manihot esculenta] 74 3e-12 OAY32607.1 hypothetical protein MANES_13G031400 [Manihot esculenta] 72 1e-11 XP_017971825.1 PREDICTED: spermidine synthase [Theobroma cacao] 72 1e-11 EOY00385.1 Spermidine synthase 1 [Theobroma cacao] 72 1e-11 AGW82430.1 spermidine synthase [Camellia sinensis] 72 1e-11 XP_008221787.1 PREDICTED: spermidine synthase [Prunus mume] 72 1e-11 XP_007222503.1 hypothetical protein PRUPE_ppa008283mg [Prunus pe... 72 1e-11 JAU06054.1 Spermidine synthase 1, partial [Noccaea caerulescens] 71 2e-11 AFF18802.1 spermidine synthase, partial [Dimocarpus longan] 69 2e-11 JAU29239.1 Spermidine synthase 1, partial [Noccaea caerulescens] 71 3e-11 XP_006416052.1 hypothetical protein EUTSA_v10007822mg [Eutrema s... 71 3e-11 JAU74045.1 Spermidine synthase 1 [Noccaea caerulescens] 71 3e-11 JAU99003.1 Spermidine synthase 1, partial [Noccaea caerulescens] 71 4e-11 KZM83525.1 hypothetical protein DCAR_031094 [Daucus carota subsp... 70 4e-11 XP_017227286.1 PREDICTED: spermidine synthase 1 [Daucus carota s... 70 5e-11 XP_010023584.1 PREDICTED: spermidine synthase 1 [Eucalyptus gran... 70 5e-11 OMO52782.1 Spermidine/spermine synthases family [Corchorus olito... 70 5e-11 >ACT21542.1 spermidine synthase [Panax ginseng] Length = 333 Score = 84.3 bits (207), Expect = 4e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +1 Query: 1 PVDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVNAIDADDSKSNRPLKFYNAEIH AAFCLPSF Sbjct: 285 PVDFKHPVNAIDADDSKSNRPLKFYNAEIHVAAFCLPSF 323 >AFH96952.1 spermidine synthase [Eleutherococcus senticosus] Length = 333 Score = 79.7 bits (195), Expect = 2e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 1 PVDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVNAIDA D KSNRPLKFYN+EIHAAAFCLPSF Sbjct: 285 PVDFKHPVNAIDAADCKSNRPLKFYNSEIHAAAFCLPSF 323 >XP_002534321.1 PREDICTED: spermidine synthase 1 [Ricinus communis] EEF28057.1 spermidine synthase 1, putative [Ricinus communis] Length = 346 Score = 73.9 bits (180), Expect = 2e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 4 VDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 VDFKHPVN IDA DSKS RPLKFYN+EIH+AAFCLPSF Sbjct: 299 VDFKHPVNPIDAKDSKSTRPLKFYNSEIHSAAFCLPSF 336 >OAY34570.1 hypothetical protein MANES_12G030300 [Manihot esculenta] Length = 341 Score = 73.6 bits (179), Expect = 3e-12 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +1 Query: 1 PVDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVNAIDA D KS PLKFYN+EIH AAFCLPSF Sbjct: 293 PVDFKHPVNAIDAYDGKSTTPLKFYNSEIHTAAFCLPSF 331 >OAY32607.1 hypothetical protein MANES_13G031400 [Manihot esculenta] Length = 342 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 4 VDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 VDFKHPVN IDADD S RP+KFYN+EIH AAFCLPSF Sbjct: 295 VDFKHPVNPIDADDDNSRRPMKFYNSEIHTAAFCLPSF 332 >XP_017971825.1 PREDICTED: spermidine synthase [Theobroma cacao] Length = 346 Score = 72.0 bits (175), Expect = 1e-11 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = +1 Query: 1 PVDFKHPVNAIDADDS--KSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVN ID+DDS KS RPL+FYN+EIH+AAFCLPSF Sbjct: 297 PVDFKHPVNPIDSDDSCCKSKRPLRFYNSEIHSAAFCLPSF 337 >EOY00385.1 Spermidine synthase 1 [Theobroma cacao] Length = 346 Score = 72.0 bits (175), Expect = 1e-11 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = +1 Query: 1 PVDFKHPVNAIDADDS--KSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVN ID+DDS KS RPL+FYN+EIH+AAFCLPSF Sbjct: 297 PVDFKHPVNPIDSDDSCCKSKRPLRFYNSEIHSAAFCLPSF 337 >AGW82430.1 spermidine synthase [Camellia sinensis] Length = 329 Score = 71.6 bits (174), Expect = 1e-11 Identities = 34/41 (82%), Positives = 36/41 (87%), Gaps = 2/41 (4%) Frame = +1 Query: 1 PVDFKHPVNAIDADDS--KSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVN IDADDS KS PLKFYN+EIHAA+FCLPSF Sbjct: 279 PVDFKHPVNPIDADDSHCKSKGPLKFYNSEIHAASFCLPSF 319 >XP_008221787.1 PREDICTED: spermidine synthase [Prunus mume] Length = 338 Score = 71.6 bits (174), Expect = 1e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 4 VDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 VDFKHPVN IDA+DS+ +RPLKFYN+EIH AAFCLPSF Sbjct: 291 VDFKHPVNPIDANDSQKSRPLKFYNSEIHTAAFCLPSF 328 >XP_007222503.1 hypothetical protein PRUPE_ppa008283mg [Prunus persica] ONI30520.1 hypothetical protein PRUPE_1G255300 [Prunus persica] Length = 338 Score = 71.6 bits (174), Expect = 1e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 4 VDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 VDFKHPVN IDA+DS+ +RPLKFYN+EIH AAFCLPSF Sbjct: 291 VDFKHPVNPIDANDSQKSRPLKFYNSEIHTAAFCLPSF 328 >JAU06054.1 Spermidine synthase 1, partial [Noccaea caerulescens] Length = 287 Score = 70.9 bits (172), Expect = 2e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 4 VDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 VDFKHPVN ID SKSN PLKFYNAEIH+AAFCLPSF Sbjct: 240 VDFKHPVNPIDESSSKSNGPLKFYNAEIHSAAFCLPSF 277 >AFF18802.1 spermidine synthase, partial [Dimocarpus longan] Length = 165 Score = 68.6 bits (166), Expect = 2e-11 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 2/41 (4%) Frame = +1 Query: 1 PVDFKHPVNAIDADD--SKSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVN IDAD+ SKS PLKFYN+EIH+AAFCLP+F Sbjct: 117 PVDFKHPVNPIDADNNHSKSRGPLKFYNSEIHSAAFCLPTF 157 >JAU29239.1 Spermidine synthase 1, partial [Noccaea caerulescens] Length = 397 Score = 70.9 bits (172), Expect = 3e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 4 VDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 VDFKHPVN ID SKSN PLKFYNAEIH+AAFCLPSF Sbjct: 350 VDFKHPVNPIDESSSKSNGPLKFYNAEIHSAAFCLPSF 387 >XP_006416052.1 hypothetical protein EUTSA_v10007822mg [Eutrema salsugineum] ESQ34405.1 hypothetical protein EUTSA_v10007822mg [Eutrema salsugineum] Length = 397 Score = 70.9 bits (172), Expect = 3e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 4 VDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 VDFKHPVN ID SKSN PLKFYNAEIH+AAFCLPSF Sbjct: 350 VDFKHPVNPIDESSSKSNGPLKFYNAEIHSAAFCLPSF 387 >JAU74045.1 Spermidine synthase 1 [Noccaea caerulescens] Length = 401 Score = 70.9 bits (172), Expect = 3e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 4 VDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 VDFKHPVN ID SKSN PLKFYNAEIH+AAFCLPSF Sbjct: 354 VDFKHPVNPIDESSSKSNGPLKFYNAEIHSAAFCLPSF 391 >JAU99003.1 Spermidine synthase 1, partial [Noccaea caerulescens] Length = 436 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 4 VDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 VDFKHPVN ID SKSN PLKFYNAEIH+AAFCLPSF Sbjct: 389 VDFKHPVNPIDESSSKSNGPLKFYNAEIHSAAFCLPSF 426 >KZM83525.1 hypothetical protein DCAR_031094 [Daucus carota subsp. sativus] Length = 294 Score = 70.1 bits (170), Expect = 4e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +1 Query: 1 PVDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVN ID DSKS+RPLKFYN+EIH AAFCLPSF Sbjct: 248 PVDFKHPVNPID--DSKSDRPLKFYNSEIHEAAFCLPSF 284 >XP_017227286.1 PREDICTED: spermidine synthase 1 [Daucus carota subsp. sativus] Length = 335 Score = 70.1 bits (170), Expect = 5e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +1 Query: 1 PVDFKHPVNAIDADDSKSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVN ID DSKS+RPLKFYN+EIH AAFCLPSF Sbjct: 289 PVDFKHPVNPID--DSKSDRPLKFYNSEIHEAAFCLPSF 325 >XP_010023584.1 PREDICTED: spermidine synthase 1 [Eucalyptus grandis] KCW59895.1 hypothetical protein EUGRSUZ_H02622 [Eucalyptus grandis] Length = 341 Score = 70.1 bits (170), Expect = 5e-11 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = +1 Query: 1 PVDFKHPVNAIDADD--SKSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVN IDAD SK+ RPLKFYN+EIH AAFCLPSF Sbjct: 291 PVDFKHPVNPIDADGALSKTRRPLKFYNSEIHTAAFCLPSF 331 >OMO52782.1 Spermidine/spermine synthases family [Corchorus olitorius] Length = 344 Score = 70.1 bits (170), Expect = 5e-11 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 2/41 (4%) Frame = +1 Query: 1 PVDFKHPVNAIDADD--SKSNRPLKFYNAEIHAAAFCLPSF 117 PVDFKHPVN ID D+ SKS RPL+FYN+EIH+AAFCLPSF Sbjct: 295 PVDFKHPVNPIDTDENCSKSKRPLRFYNSEIHSAAFCLPSF 335