BLASTX nr result
ID: Panax25_contig00013220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00013220 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015081953.1 PREDICTED: translation initiation factor IF-2, ch... 65 6e-10 XP_006366769.1 PREDICTED: translation initiation factor IF-2, ch... 65 6e-10 XP_004243227.1 PREDICTED: translation initiation factor IF-2, ch... 65 6e-10 XP_017252384.1 PREDICTED: translation initiation factor IF-2, ch... 61 2e-08 XP_019249551.1 PREDICTED: translation initiation factor IF-2, ch... 61 3e-08 XP_009790742.1 PREDICTED: translation initiation factor IF-2, ch... 61 3e-08 XP_009601340.1 PREDICTED: translation initiation factor IF-2, ch... 61 3e-08 XP_019193404.1 PREDICTED: translation initiation factor IF-2, ch... 61 3e-08 KZM94316.1 hypothetical protein DCAR_017559 [Daucus carota subsp... 61 3e-08 CDP06122.1 unnamed protein product [Coffea canephora] 60 5e-08 >XP_015081953.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Solanum pennellii] Length = 1010 Score = 65.5 bits (158), Expect = 6e-10 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 115 CTCSSGKFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 C CSSG+FEGS SLVR+VS S+NFGS ++W GKRWRY Sbjct: 14 CGCSSGQFEGSFSLVRRVSFSKNFGSVNRIWGGKRWRY 51 >XP_006366769.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Solanum tuberosum] Length = 1010 Score = 65.5 bits (158), Expect = 6e-10 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 115 CTCSSGKFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 C CSSG+FEGS SLVR+VS S+NFGS ++W GKRWRY Sbjct: 14 CGCSSGQFEGSFSLVRRVSFSKNFGSVNRIWGGKRWRY 51 >XP_004243227.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Solanum lycopersicum] Length = 1010 Score = 65.5 bits (158), Expect = 6e-10 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 115 CTCSSGKFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 C CSSG+FEGS SLVR+VS S+NFGS ++W GKRWRY Sbjct: 14 CGCSSGQFEGSFSLVRRVSFSKNFGSVNRIWGGKRWRY 51 >XP_017252384.1 PREDICTED: translation initiation factor IF-2, chloroplastic-like [Daucus carota subsp. sativus] Length = 1030 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/54 (55%), Positives = 37/54 (68%) Frame = -1 Query: 163 SITMXXXXXXXXXXXACTCSSGKFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 SI M C+CSS +FEGSLS V +VS+S++FGSFRKV VG+RWRY Sbjct: 4 SINMNSIASLVSLGSVCSCSSVQFEGSLSSVSRVSLSQSFGSFRKVKVGRRWRY 57 >XP_019249551.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Nicotiana attenuata] OIT00266.1 translation initiation factor if-2, chloroplastic [Nicotiana attenuata] Length = 1011 Score = 60.8 bits (146), Expect = 3e-08 Identities = 26/39 (66%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = -1 Query: 115 CTCSSG-KFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 C CSSG +FEGS SLVR+VS++ NF +F ++WVGKRWRY Sbjct: 14 CGCSSGGQFEGSFSLVRRVSLANNFRNFNRIWVGKRWRY 52 >XP_009790742.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Nicotiana sylvestris] XP_016514188.1 PREDICTED: translation initiation factor IF-2, chloroplastic-like [Nicotiana tabacum] Length = 1013 Score = 60.8 bits (146), Expect = 3e-08 Identities = 26/39 (66%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = -1 Query: 115 CTCSSG-KFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 C CSSG +FEGS SLVR+VS++ NF +F ++WVGKRWRY Sbjct: 14 CGCSSGGQFEGSFSLVRRVSLANNFRNFNRIWVGKRWRY 52 >XP_009601340.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Nicotiana tomentosiformis] XP_016456731.1 PREDICTED: translation initiation factor IF-2, chloroplastic-like [Nicotiana tabacum] Length = 1013 Score = 60.8 bits (146), Expect = 3e-08 Identities = 26/39 (66%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = -1 Query: 115 CTCSSG-KFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 C CSSG +FEGS SLVR+VS++ NF +F ++WVGKRWRY Sbjct: 14 CGCSSGGQFEGSFSLVRRVSLANNFRNFNRIWVGKRWRY 52 >XP_019193404.1 PREDICTED: translation initiation factor IF-2, chloroplastic [Ipomoea nil] Length = 1020 Score = 60.8 bits (146), Expect = 3e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -1 Query: 115 CTCSSGKFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 C+CSSG+FEGS LV +S ++NF SFR++WVGKRW Y Sbjct: 14 CSCSSGQFEGSSGLVGSISFAKNFRSFRRIWVGKRWPY 51 >KZM94316.1 hypothetical protein DCAR_017559 [Daucus carota subsp. sativus] Length = 1024 Score = 60.8 bits (146), Expect = 3e-08 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 115 CTCSSGKFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 C+CSS +FEGSLS V +VS+S++FGSFRKV VG+RWRY Sbjct: 14 CSCSSVQFEGSLSSVSRVSLSQSFGSFRKVKVGRRWRY 51 >CDP06122.1 unnamed protein product [Coffea canephora] Length = 1022 Score = 60.1 bits (144), Expect = 5e-08 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -1 Query: 115 CTCSSGKFEGSLSLVRKVSISRNFGSFRKVWVGKRWRY 2 CTCSSGKFEGS SL+++VS SRN+ + ++ VGKRWRY Sbjct: 16 CTCSSGKFEGSFSLIKRVSYSRNYRASPRICVGKRWRY 53