BLASTX nr result
ID: Panax25_contig00012970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00012970 (839 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP02152.1 hypothetical protein COLO4_11302 [Corchorus olitorius] 57 8e-09 XP_017241878.1 PREDICTED: CRM-domain containing factor CFM3, chl... 63 2e-07 KZN03411.1 hypothetical protein DCAR_012167 [Daucus carota subsp... 63 2e-07 >OMP02152.1 hypothetical protein COLO4_11302 [Corchorus olitorius] Length = 643 Score = 57.0 bits (136), Expect(2) = 8e-09 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +3 Query: 630 DWQC*TGGLIIMVSGSVMMVFRGSNFAGPSSRTESTDREGDNDFV 764 D Q TGGL++ SGSVM+V+RGSN+ GPSSR++S DREG+ F+ Sbjct: 70 DVQRRTGGLVLWRSGSVMVVYRGSNYEGPSSRSQSIDREGEALFI 114 Score = 31.6 bits (70), Expect(2) = 8e-09 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 436 IDDQWRISELVGFQFHQMLVPDMK 507 I D+WR ELV +FH++L DMK Sbjct: 24 IHDKWRKEELVRLKFHEVLAVDMK 47 >XP_017241878.1 PREDICTED: CRM-domain containing factor CFM3, chloroplastic/mitochondrial [Daucus carota subsp. sativus] Length = 840 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 645 TGGLIIMVSGSVMMVFRGSNFAGPSSRTESTDREGDNDFV 764 TGGL+I SGSVMMV+RGSN+AGPSSR +ST REGD FV Sbjct: 269 TGGLVIWRSGSVMMVYRGSNYAGPSSRPQSTQREGDTLFV 308 >KZN03411.1 hypothetical protein DCAR_012167 [Daucus carota subsp. sativus] Length = 1266 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 645 TGGLIIMVSGSVMMVFRGSNFAGPSSRTESTDREGDNDFV 764 TGGL+I SGSVMMV+RGSN+AGPSSR +ST REGD FV Sbjct: 264 TGGLVIWRSGSVMMVYRGSNYAGPSSRPQSTQREGDTLFV 303