BLASTX nr result
ID: Panax25_contig00012932
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00012932 (379 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB42955.1 hypothetical protein B456_007G176800 [Gossypium raimo... 72 4e-12 KJB10566.1 hypothetical protein B456_001G207700 [Gossypium raimo... 72 4e-12 XP_016696478.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_019442766.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_017616368.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_016682933.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_016672449.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_012491210.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_017627291.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_017616287.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_016746068.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_010099312.1 putative tRNA (guanine(26)-N(2))-dimethyltransfer... 72 4e-12 XP_012488303.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_007032854.2 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 KHG28637.1 hypothetical protein F383_15004 [Gossypium arboreum] 72 4e-12 EOY03780.1 N2,N2-dimethylguanosine tRNA methyltransferase [Theob... 72 4e-12 XP_011008612.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_011021069.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 XP_002306060.2 hypothetical protein POPTR_0004s11710g [Populus t... 72 4e-12 XP_010032565.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimet... 72 4e-12 >KJB42955.1 hypothetical protein B456_007G176800 [Gossypium raimondii] Length = 408 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 194 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 227 >KJB10566.1 hypothetical protein B456_001G207700 [Gossypium raimondii] Length = 434 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 57 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 90 >XP_016696478.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Gossypium hirsutum] Length = 488 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 192 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 225 >XP_019442766.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 isoform X4 [Lupinus angustifolius] Length = 538 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 220 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 253 >XP_017616368.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 isoform X2 [Gossypium arboreum] Length = 550 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 173 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 206 >XP_016682933.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Gossypium hirsutum] Length = 569 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 192 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 225 >XP_016672449.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Gossypium hirsutum] Length = 571 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 194 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 227 >XP_012491210.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Gossypium raimondii] KJB42954.1 hypothetical protein B456_007G176800 [Gossypium raimondii] Length = 571 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 194 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 227 >XP_017627291.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Gossypium arboreum] KHG07275.1 hypothetical protein F383_15640 [Gossypium arboreum] KHG08963.1 hypothetical protein F383_11220 [Gossypium arboreum] Length = 571 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 194 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 227 >XP_017616287.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 isoform X1 [Gossypium arboreum] Length = 580 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 203 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 236 >XP_016746068.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Gossypium hirsutum] XP_016746069.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Gossypium hirsutum] Length = 580 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 203 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 236 >XP_010099312.1 putative tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Morus notabilis] EXB77658.1 putative tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Morus notabilis] Length = 580 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 203 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 236 >XP_012488303.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Gossypium raimondii] XP_012488317.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Gossypium raimondii] KJB10563.1 hypothetical protein B456_001G207700 [Gossypium raimondii] KJB10564.1 hypothetical protein B456_001G207700 [Gossypium raimondii] KJB10565.1 hypothetical protein B456_001G207700 [Gossypium raimondii] Length = 580 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 203 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 236 >XP_007032854.2 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Theobroma cacao] Length = 581 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 203 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 236 >KHG28637.1 hypothetical protein F383_15004 [Gossypium arboreum] Length = 581 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 204 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 237 >EOY03780.1 N2,N2-dimethylguanosine tRNA methyltransferase [Theobroma cacao] Length = 581 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 203 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 236 >XP_011008612.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Populus euphratica] Length = 582 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 204 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 237 >XP_011021069.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Populus euphratica] Length = 582 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 204 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 237 >XP_002306060.2 hypothetical protein POPTR_0004s11710g [Populus trichocarpa] EEE86571.2 hypothetical protein POPTR_0004s11710g [Populus trichocarpa] Length = 582 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 204 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 237 >XP_010032565.1 PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 [Eucalyptus grandis] KCW51962.1 hypothetical protein EUGRSUZ_J01408 [Eucalyptus grandis] Length = 583 Score = 71.6 bits (174), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 242 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 141 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA Sbjct: 203 VDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMA 236