BLASTX nr result
ID: Panax25_contig00012758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00012758 (787 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247798.1 PREDICTED: 5'-nucleotidase domain-containing prot... 64 4e-08 >XP_017247798.1 PREDICTED: 5'-nucleotidase domain-containing protein 4 isoform X1 [Daucus carota subsp. sativus] Length = 647 Score = 64.3 bits (155), Expect = 4e-08 Identities = 52/136 (38%), Positives = 67/136 (49%), Gaps = 7/136 (5%) Frame = +3 Query: 366 MNCAAGAXXXXXXXNCNRTYFINSTTLGIRPTF----DSICQQPLLLSVPKTKSKCLFKK 533 M+CA A C T + T I +F +SI + + VP LFKK Sbjct: 1 MSCATAAAATTSTSTCTTTTSTCNPTKFINSSFSLHSNSIRRITHFVKVPTWG---LFKK 57 Query: 534 -YAMRVAKRSIAFCFSLLSPLQFNSPLYS-SLVLGCPRTFTQSSIRRKGIRA-EGANQLN 704 +AMR+ KRSIA CFSL SPL+ N +S L P F+Q + RR+ + A EGA QLN Sbjct: 58 KHAMRIPKRSIASCFSLFSPLELNFSFFSPHSFLDYPSNFSQFASRRRAVCACEGAYQLN 117 Query: 705 TSFTMDSKCMDEKISE 752 TS D K S+ Sbjct: 118 TSVIFDRKMSKSAYSD 133