BLASTX nr result
ID: Panax25_contig00012691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00012691 (556 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN07038.1 hypothetical protein DCAR_007875 [Daucus carota subsp... 55 5e-07 >KZN07038.1 hypothetical protein DCAR_007875 [Daucus carota subsp. sativus] Length = 69 Score = 54.7 bits (130), Expect = 5e-07 Identities = 39/71 (54%), Positives = 46/71 (64%), Gaps = 1/71 (1%) Frame = -1 Query: 472 ARLAPVLMKLSSTNKVFLHGPSTNSILIELSETSPRTPFSAVAPPRHRHDQLP-IFSRNQ 296 ARLAP++ ++KV PS +EL ++S RTPFSAVAPP RHDQLP F R Q Sbjct: 6 ARLAPMMF----SSKVLR--PSIFQPKVELPQSSTRTPFSAVAPP-CRHDQLPQPFFRIQ 58 Query: 295 TPKILETIFEE 263 K LETIFEE Sbjct: 59 PQKNLETIFEE 69