BLASTX nr result
ID: Panax25_contig00011975
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00011975 (806 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006485864.2 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-06 KDO42602.1 hypothetical protein CISIN_1g044775mg [Citrus sinensis] 60 1e-06 XP_006436291.1 hypothetical protein CICLE_v10033724mg, partial [... 60 1e-06 JAU07629.1 Putative pentatricopeptide repeat-containing protein,... 55 5e-06 KCW60575.1 hypothetical protein EUGRSUZ_H03306 [Eucalyptus grandis] 57 9e-06 XP_015570529.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-05 XP_010024144.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-05 >XP_006485864.2 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Citrus sinensis] Length = 482 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 461 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 565 +DLLGRAGQ+SEAE LIE+MPM+ DAS WGSLLGA Sbjct: 254 VDLLGRAGQVSEAEKLIENMPMEPDASLWGSLLGA 288 >KDO42602.1 hypothetical protein CISIN_1g044775mg [Citrus sinensis] Length = 552 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 461 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 565 +DLLGRAGQ+SEAE LIE+MPM+ DAS WGSLLGA Sbjct: 345 VDLLGRAGQVSEAEKLIENMPMEPDASLWGSLLGA 379 >XP_006436291.1 hypothetical protein CICLE_v10033724mg, partial [Citrus clementina] ESR49531.1 hypothetical protein CICLE_v10033724mg, partial [Citrus clementina] Length = 580 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 461 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 565 +DLLGRAGQ+SEAE LIE+MPM+ DAS WGSLLGA Sbjct: 352 VDLLGRAGQVSEAEKLIENMPMEPDASLWGSLLGA 386 >JAU07629.1 Putative pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 123 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +2 Query: 434 DVNNCDVKTIDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 565 D+ NC +DLLGRAG++ EA L+E+MP K D STWG++LGA Sbjct: 12 DIYNC---VVDLLGRAGKIGEAYELVETMPFKPDESTWGAILGA 52 >KCW60575.1 hypothetical protein EUGRSUZ_H03306 [Eucalyptus grandis] Length = 641 Score = 57.4 bits (137), Expect = 9e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 461 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 565 +DLLGRAG+L EAE LIESMPM D STWG+LLGA Sbjct: 413 VDLLGRAGKLKEAEELIESMPMAPDVSTWGALLGA 447 >XP_015570529.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Ricinus communis] Length = 797 Score = 57.4 bits (137), Expect = 1e-05 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 461 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 565 +DLLGRAG L EAE LIE+MPM DASTWG+LLGA Sbjct: 569 VDLLGRAGMLKEAEELIENMPMAPDASTWGALLGA 603 >XP_010024144.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Eucalyptus grandis] XP_010024145.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Eucalyptus grandis] XP_010024147.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890 [Eucalyptus grandis] Length = 797 Score = 57.4 bits (137), Expect = 1e-05 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 461 IDLLGRAGQLSEAELLIESMPMKADASTWGSLLGA 565 +DLLGRAG+L EAE LIESMPM D STWG+LLGA Sbjct: 569 VDLLGRAGKLKEAEELIESMPMAPDVSTWGALLGA 603