BLASTX nr result
ID: Panax25_contig00011231
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00011231 (441 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY41770.1 hypothetical protein MANES_09G128400 [Manihot esculen... 74 2e-12 XP_015575204.1 PREDICTED: WEB family protein At5g16730, chloropl... 72 9e-12 XP_002520069.1 PREDICTED: WEB family protein At5g16730, chloropl... 72 9e-12 XP_015878582.1 PREDICTED: WEB family protein At3g02930, chloropl... 70 3e-11 XP_015069724.1 PREDICTED: WEB family protein At3g02930, chloropl... 70 4e-11 XP_004235278.1 PREDICTED: WEB family protein At3g02930, chloropl... 70 4e-11 XP_002325804.2 hypothetical protein POPTR_0019s07200g [Populus t... 69 6e-11 XP_002319250.2 hypothetical protein POPTR_0013s07650g [Populus t... 69 6e-11 XP_012070237.1 PREDICTED: WEB family protein At5g16730, chloropl... 69 1e-10 APR63972.1 hypothetical protein [Populus tomentosa] 68 1e-10 XP_016564116.1 PREDICTED: WEB family protein At3g02930, chloropl... 68 1e-10 XP_006347593.1 PREDICTED: WEB family protein At3g02930, chloropl... 67 3e-10 CBI26484.3 unnamed protein product, partial [Vitis vinifera] 67 4e-10 XP_002270776.2 PREDICTED: WEB family protein At5g16730, chloropl... 67 4e-10 XP_011012023.1 PREDICTED: WEB family protein At3g02930, chloropl... 66 7e-10 OAY43368.1 hypothetical protein MANES_08G064500 [Manihot esculenta] 66 7e-10 KYP52713.1 hypothetical protein KK1_025458 [Cajanus cajan] 66 9e-10 XP_016511979.1 PREDICTED: WEB family protein At3g02930, chloropl... 66 9e-10 XP_018627854.1 PREDICTED: WEB family protein At5g16730, chloropl... 66 9e-10 XP_016472302.1 PREDICTED: WEB family protein At3g02930, chloropl... 66 9e-10 >OAY41770.1 hypothetical protein MANES_09G128400 [Manihot esculenta] OAY41771.1 hypothetical protein MANES_09G128400 [Manihot esculenta] OAY41772.1 hypothetical protein MANES_09G128400 [Manihot esculenta] Length = 841 Score = 73.6 bits (179), Expect = 2e-12 Identities = 35/55 (63%), Positives = 46/55 (83%), Gaps = 1/55 (1%) Frame = -1 Query: 441 DREPEKESV-DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +REPEKES DE+DS EG E+ DQINGLS TEN+++GG+SP+++Q QKKK+ LL Sbjct: 771 EREPEKESCEDEVDSKVEGGESLDQINGLSSTENVDDGGSSPSEQQQQKKKKPLL 825 >XP_015575204.1 PREDICTED: WEB family protein At5g16730, chloroplastic isoform X2 [Ricinus communis] Length = 838 Score = 71.6 bits (174), Expect = 9e-12 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 441 DREPEKESV-DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +RE E+ES DE DS EG E FDQINGLS TEN+E+GG SP+K+Q QKKK+ LL Sbjct: 768 ERETEQESFEDEGDSKAEGGEGFDQINGLSLTENVEDGGCSPSKQQQQKKKKPLL 822 >XP_002520069.1 PREDICTED: WEB family protein At5g16730, chloroplastic isoform X1 [Ricinus communis] EEF42393.1 ATP binding protein, putative [Ricinus communis] Length = 841 Score = 71.6 bits (174), Expect = 9e-12 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 441 DREPEKESV-DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +RE E+ES DE DS EG E FDQINGLS TEN+E+GG SP+K+Q QKKK+ LL Sbjct: 771 ERETEQESFEDEGDSKAEGGEGFDQINGLSLTENVEDGGCSPSKQQQQKKKKPLL 825 >XP_015878582.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like [Ziziphus jujuba] Length = 855 Score = 70.1 bits (170), Expect = 3e-11 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 1/55 (1%) Frame = -1 Query: 441 DREPEKESVDE-LDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +REPE+ES +E +DS EG E FDQ+NG+S TEN ++GG+SPTK+ QKKK+ LL Sbjct: 785 EREPEQESFEEEVDSKVEGGEGFDQLNGVSLTENNDDGGSSPTKQLQQKKKKPLL 839 >XP_015069724.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like [Solanum pennellii] Length = 969 Score = 69.7 bits (169), Expect = 4e-11 Identities = 35/56 (62%), Positives = 42/56 (75%), Gaps = 2/56 (3%) Frame = -1 Query: 441 DREPEKESV--DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 D PE+E+V +E DS TE E++DQ+NGL EN ENGGTSPTK QSQKKK+ LL Sbjct: 898 DFSPERETVQEEESDSKTEAGESYDQVNGLPSAENPENGGTSPTKPQSQKKKKPLL 953 >XP_004235278.1 PREDICTED: WEB family protein At3g02930, chloroplastic [Solanum lycopersicum] Length = 969 Score = 69.7 bits (169), Expect = 4e-11 Identities = 35/56 (62%), Positives = 42/56 (75%), Gaps = 2/56 (3%) Frame = -1 Query: 441 DREPEKESV--DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 D PE+E+V +E DS TE E++DQ+NGL EN ENGGTSPTK QSQKKK+ LL Sbjct: 898 DFSPERETVQEEESDSKTEAGESYDQVNGLPSAENPENGGTSPTKPQSQKKKKPLL 953 >XP_002325804.2 hypothetical protein POPTR_0019s07200g [Populus trichocarpa] EEF00186.2 hypothetical protein POPTR_0019s07200g [Populus trichocarpa] Length = 847 Score = 69.3 bits (168), Expect = 6e-11 Identities = 33/55 (60%), Positives = 45/55 (81%), Gaps = 1/55 (1%) Frame = -1 Query: 441 DREPEKESVDE-LDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +RE E+ES +E +DS +G E+FDQ NGLS TEN+++GG+SPTK+Q QKKK+ LL Sbjct: 777 EREMEQESFEEKVDSKVDGGESFDQTNGLSSTENVDDGGSSPTKQQQQKKKKPLL 831 >XP_002319250.2 hypothetical protein POPTR_0013s07650g [Populus trichocarpa] EEE95173.2 hypothetical protein POPTR_0013s07650g [Populus trichocarpa] Length = 850 Score = 69.3 bits (168), Expect = 6e-11 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = -1 Query: 441 DREPEKESV--DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +RE E ES DE DS +G E+FDQINGLS TEN+++GG+SP+K+Q QKKK+ LL Sbjct: 779 ERETEHESSFEDEADSKVDGGESFDQINGLSSTENVDDGGSSPSKQQQQKKKKPLL 834 >XP_012070237.1 PREDICTED: WEB family protein At5g16730, chloroplastic-like [Jatropha curcas] KDP39535.1 hypothetical protein JCGZ_02555 [Jatropha curcas] Length = 843 Score = 68.6 bits (166), Expect = 1e-10 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 441 DREPEKESV-DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +RE E ES DE+DS EG E+FDQ+NGLS EN+++G TSP+K+Q QKKK+ LL Sbjct: 773 EREHEHESFEDEVDSKAEGGESFDQVNGLSSVENVDDGATSPSKQQQQKKKKPLL 827 >APR63972.1 hypothetical protein [Populus tomentosa] Length = 850 Score = 68.2 bits (165), Expect = 1e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = -1 Query: 441 DREPEKESV--DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +RE E ES DE+DS +G E+FDQINGLS TEN+++GG+SP+K Q QKKK+ LL Sbjct: 779 ERETEHESSFEDEVDSKVDGGESFDQINGLSSTENVDDGGSSPSKLQQQKKKKPLL 834 >XP_016564116.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like [Capsicum annuum] Length = 969 Score = 68.2 bits (165), Expect = 1e-10 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = -1 Query: 441 DREPEKESV--DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 D PE+ESV DE +S T+ E+FDQINGL EN ENGGTSPTK SQKKK+ LL Sbjct: 898 DFSPERESVQEDESESKTDFGESFDQINGLPTAENPENGGTSPTKTSSQKKKKPLL 953 >XP_006347593.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like [Solanum tuberosum] Length = 969 Score = 67.4 bits (163), Expect = 3e-10 Identities = 34/56 (60%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = -1 Query: 441 DREPEKESV--DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 D PE+E+V +E DS TE E++DQ+NGL EN EN GTSPTK QSQKKK+ LL Sbjct: 898 DFSPERETVQEEESDSKTEAGESYDQVNGLPSAENPENAGTSPTKPQSQKKKKPLL 953 >CBI26484.3 unnamed protein product, partial [Vitis vinifera] Length = 825 Score = 67.0 bits (162), Expect = 4e-10 Identities = 35/55 (63%), Positives = 44/55 (80%), Gaps = 1/55 (1%) Frame = -1 Query: 441 DREPEKESVDE-LDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +RE E S +E +DS EG ++FDQINGLS +ENL+NGG+SPTK+Q QKKKR LL Sbjct: 756 ERETEHGSFEEDVDSKAEGGDSFDQINGLS-SENLDNGGSSPTKQQQQKKKRPLL 809 >XP_002270776.2 PREDICTED: WEB family protein At5g16730, chloroplastic [Vitis vinifera] XP_010662099.1 PREDICTED: WEB family protein At5g16730, chloroplastic [Vitis vinifera] XP_010662100.1 PREDICTED: WEB family protein At5g16730, chloroplastic [Vitis vinifera] Length = 846 Score = 67.0 bits (162), Expect = 4e-10 Identities = 35/55 (63%), Positives = 44/55 (80%), Gaps = 1/55 (1%) Frame = -1 Query: 441 DREPEKESVDE-LDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +RE E S +E +DS EG ++FDQINGLS +ENL+NGG+SPTK+Q QKKKR LL Sbjct: 777 ERETEHGSFEEDVDSKAEGGDSFDQINGLS-SENLDNGGSSPTKQQQQKKKRPLL 830 >XP_011012023.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like [Populus euphratica] Length = 838 Score = 66.2 bits (160), Expect = 7e-10 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -1 Query: 435 EPEKESVDE-LDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 E E+ES +E +DS +G E+FDQ NGLS TEN+++GG+SP K+Q QKKKR LL Sbjct: 771 EKEQESFEEKVDSKVDGGESFDQTNGLSSTENVDDGGSSPAKQQQQKKKRPLL 823 >OAY43368.1 hypothetical protein MANES_08G064500 [Manihot esculenta] Length = 843 Score = 66.2 bits (160), Expect = 7e-10 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 2/55 (3%) Frame = -1 Query: 441 DREPEKESV-DELDSNTEGNENFDQINGLSFTENLE-NGGTSPTKEQSQKKKRAL 283 DREPE+ES DE++S +G E+FDQINGLS EN++ NGG+SP+K+ QKKK+ L Sbjct: 772 DREPEQESFEDEVESKVDGGESFDQINGLSSAENVDSNGGSSPSKQPQQKKKKPL 826 >KYP52713.1 hypothetical protein KK1_025458 [Cajanus cajan] Length = 584 Score = 65.9 bits (159), Expect = 9e-10 Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -1 Query: 441 DREPEKESVDE-LDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 +R+PE ES +E DS EG E FDQING S EN +NGG SP+K+Q +KKK+ LL Sbjct: 514 ERDPEPESFEEEADSKIEGGEGFDQINGTSLKENADNGGNSPSKQQVKKKKKPLL 568 >XP_016511979.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like [Nicotiana tabacum] Length = 924 Score = 65.9 bits (159), Expect = 9e-10 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 2/56 (3%) Frame = -1 Query: 441 DREPEKESV--DELDSNTEGNENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 D PE+E+V +E +S T+ E+FDQ+NG+ EN ENGGTSPTK QSQKKK+ LL Sbjct: 853 DFSPERETVQEEESESKTDVGESFDQVNGVPSAENPENGGTSPTKPQSQKKKKPLL 908 >XP_018627854.1 PREDICTED: WEB family protein At5g16730, chloroplastic-like isoform X2 [Nicotiana tomentosiformis] Length = 944 Score = 65.9 bits (159), Expect = 9e-10 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 2/56 (3%) Frame = -1 Query: 441 DREPEKESVDELDSNTEGN--ENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 D PE+E+V E +S ++ + E+FDQ+NGL EN ENGGTSPTK+QSQKKK+ LL Sbjct: 873 DFSPERETVQEEESESKKDVGESFDQVNGLPSAENPENGGTSPTKQQSQKKKKPLL 928 >XP_016472302.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like [Nicotiana tabacum] Length = 965 Score = 65.9 bits (159), Expect = 9e-10 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 2/56 (3%) Frame = -1 Query: 441 DREPEKESVDELDSNTEGN--ENFDQINGLSFTENLENGGTSPTKEQSQKKKRALL 280 D PE+E+V E +S ++ + E+FDQ+NGL EN ENGGTSPTK+QSQKKK+ LL Sbjct: 894 DFSPERETVQEEESESKKDVGESFDQVNGLPSAENPENGGTSPTKQQSQKKKKPLL 949