BLASTX nr result
ID: Panax25_contig00011092
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00011092 (650 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013898021.1 hypothetical protein MNEG_8959 [Monoraphidium neg... 64 2e-09 XP_010540630.1 PREDICTED: CTP synthase [Tarenaya hassleriana] 66 4e-09 XP_018487509.1 PREDICTED: CTP synthase-like [Raphanus sativus] 64 5e-09 XP_019446966.1 PREDICTED: CTP synthase-like isoform X2 [Lupinus ... 66 5e-09 OIT02451.1 hypothetical protein A4A49_34053 [Nicotiana attenuata] 62 5e-09 GAU35442.1 hypothetical protein TSUD_363980 [Trifolium subterran... 66 5e-09 XP_018805167.1 PREDICTED: CTP synthase-like isoform X2 [Juglans ... 64 5e-09 AAV50011.1 CTP synthase 1a, partial [Malus domestica] AAV50012.1... 61 5e-09 XP_019446965.1 PREDICTED: CTP synthase-like isoform X1 [Lupinus ... 66 5e-09 ACJ83882.1 unknown, partial [Medicago truncatula] 64 9e-09 OMO63632.1 CTP synthase [Corchorus olitorius] 65 9e-09 OMO84839.1 CTP synthase [Corchorus capsularis] 65 1e-08 XP_018830366.1 PREDICTED: CTP synthase-like [Juglans regia] XP_0... 65 1e-08 XP_010924874.1 PREDICTED: CTP synthase isoform X2 [Elaeis guinee... 65 1e-08 XP_010924873.1 PREDICTED: CTP synthase isoform X1 [Elaeis guinee... 65 1e-08 XP_018805166.1 PREDICTED: CTP synthase-like isoform X1 [Juglans ... 64 1e-08 XP_017412925.1 PREDICTED: CTP synthase-like [Vigna angularis] 64 1e-08 XP_009420677.1 PREDICTED: CTP synthase isoform X1 [Musa acuminat... 65 1e-08 XP_010538283.1 PREDICTED: CTP synthase-like [Tarenaya hassleriana] 65 1e-08 XP_009420685.1 PREDICTED: CTP synthase isoform X3 [Musa acuminat... 65 1e-08 >XP_013898021.1 hypothetical protein MNEG_8959 [Monoraphidium neglectum] KIY99001.1 hypothetical protein MNEG_8959 [Monoraphidium neglectum] Length = 139 Score = 63.5 bits (153), Expect = 2e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 470 DPYLNTDAGTMSPFEHGEVFVLDDGGEV Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 67 >XP_010540630.1 PREDICTED: CTP synthase [Tarenaya hassleriana] Length = 614 Score = 66.2 bits (160), Expect = 4e-09 Identities = 37/67 (55%), Positives = 44/67 (65%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R ++ +L R +++ KI Y Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER---FLDIKLTRDNNITTGKIYQY 96 Query: 373 YNDYSRK 353 D RK Sbjct: 97 VLDKERK 103 >XP_018487509.1 PREDICTED: CTP synthase-like [Raphanus sativus] Length = 196 Score = 63.9 bits (154), Expect = 5e-09 Identities = 37/67 (55%), Positives = 42/67 (62%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R ++ L R +L+ KI Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER---FLDSTLTRDNNLTTGKIYQA 96 Query: 373 YNDYSRK 353 D RK Sbjct: 97 VIDKERK 103 >XP_019446966.1 PREDICTED: CTP synthase-like isoform X2 [Lupinus angustifolius] Length = 470 Score = 65.9 bits (159), Expect = 5e-09 Identities = 39/67 (58%), Positives = 45/67 (67%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R FM I +L R +++ KI + Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER-FMDI--KLTRDNNITTGKIYQF 96 Query: 373 YNDYSRK 353 D RK Sbjct: 97 VIDKERK 103 >OIT02451.1 hypothetical protein A4A49_34053 [Nicotiana attenuata] Length = 114 Score = 62.0 bits (149), Expect = 5e-09 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGE 473 DPYLNTDAGTMSPFEHGEVFVLDDGGE Sbjct: 85 DPYLNTDAGTMSPFEHGEVFVLDDGGE 111 >GAU35442.1 hypothetical protein TSUD_363980 [Trifolium subterraneum] Length = 504 Score = 65.9 bits (159), Expect = 5e-09 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKI 383 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R F+HI +L R+ +++ KI Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER-FLHI--KLTRENNITTGKI 93 >XP_018805167.1 PREDICTED: CTP synthase-like isoform X2 [Juglans regia] Length = 181 Score = 63.5 bits (153), Expect = 5e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 470 DPYLNTDAGTMSPFEHGEVFVLDDGGEV Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 67 >AAV50011.1 CTP synthase 1a, partial [Malus domestica] AAV50012.1 CTP synthase 1b, partial [Malus domestica] Length = 76 Score = 60.8 bits (146), Expect = 5e-09 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 470 DPYLNTDAGTMSP EHGEVFVLDDGGEV Sbjct: 40 DPYLNTDAGTMSPVEHGEVFVLDDGGEV 67 >XP_019446965.1 PREDICTED: CTP synthase-like isoform X1 [Lupinus angustifolius] Length = 603 Score = 65.9 bits (159), Expect = 5e-09 Identities = 39/67 (58%), Positives = 45/67 (67%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R FM I +L R +++ KI + Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER-FMDI--KLTRDNNITTGKIYQF 96 Query: 373 YNDYSRK 353 D RK Sbjct: 97 VIDKERK 103 >ACJ83882.1 unknown, partial [Medicago truncatula] Length = 218 Score = 63.5 bits (153), Expect = 9e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 470 DPYLNTDAGTMSPFEHGEVFVLDDGGEV Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 67 >OMO63632.1 CTP synthase [Corchorus olitorius] Length = 603 Score = 65.1 bits (157), Expect = 9e-09 Identities = 36/67 (53%), Positives = 44/67 (65%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R ++ +L R +++ KI Y Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER---FLDIKLTRDNNITTGKIYQY 96 Query: 373 YNDYSRK 353 D R+ Sbjct: 97 VIDKERR 103 >OMO84839.1 CTP synthase [Corchorus capsularis] Length = 605 Score = 65.1 bits (157), Expect = 1e-08 Identities = 36/67 (53%), Positives = 44/67 (65%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R ++ +L R +++ KI Y Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER---FLDIKLTRDNNITTGKIYQY 96 Query: 373 YNDYSRK 353 D R+ Sbjct: 97 VIDKERR 103 >XP_018830366.1 PREDICTED: CTP synthase-like [Juglans regia] XP_018830368.1 PREDICTED: CTP synthase-like [Juglans regia] XP_018830369.1 PREDICTED: CTP synthase-like [Juglans regia] Length = 606 Score = 65.1 bits (157), Expect = 1e-08 Identities = 36/67 (53%), Positives = 44/67 (65%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R ++ +L R +++ KI Y Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER---FLDIKLTRDNNITTGKIYQY 96 Query: 373 YNDYSRK 353 D R+ Sbjct: 97 VIDKERR 103 >XP_010924874.1 PREDICTED: CTP synthase isoform X2 [Elaeis guineensis] Length = 609 Score = 65.1 bits (157), Expect = 1e-08 Identities = 36/67 (53%), Positives = 44/67 (65%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R ++ +L R +++ KI Y Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER---FLDIKLTRDNNITTGKIYQY 96 Query: 373 YNDYSRK 353 D R+ Sbjct: 97 VLDKERR 103 >XP_010924873.1 PREDICTED: CTP synthase isoform X1 [Elaeis guineensis] XP_019706935.1 PREDICTED: CTP synthase isoform X1 [Elaeis guineensis] Length = 625 Score = 65.1 bits (157), Expect = 1e-08 Identities = 36/67 (53%), Positives = 44/67 (65%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGEV + R ++ +L R +++ KI Y Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYER---FLDIKLTRDNNITTGKIYQY 96 Query: 373 YNDYSRK 353 D R+ Sbjct: 97 VLDKERR 103 >XP_018805166.1 PREDICTED: CTP synthase-like isoform X1 [Juglans regia] Length = 232 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 470 DPYLNTDAGTMSPFEHGEVFVLDDGGEV Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 67 >XP_017412925.1 PREDICTED: CTP synthase-like [Vigna angularis] Length = 244 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 470 DPYLNTDAGTMSPFEHGEVFVLDDGGEV Sbjct: 14 DPYLNTDAGTMSPFEHGEVFVLDDGGEV 41 >XP_009420677.1 PREDICTED: CTP synthase isoform X1 [Musa acuminata subsp. malaccensis] Length = 613 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFF 464 DPYLNTDAGTMSPFEHGEVFVLDDGGEV F Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDF 69 >XP_010538283.1 PREDICTED: CTP synthase-like [Tarenaya hassleriana] Length = 614 Score = 64.7 bits (156), Expect = 1e-08 Identities = 36/67 (53%), Positives = 43/67 (64%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFFSFC*FIRSFMHIEQQLRRKLHLSVIKIEFY 374 DPYLNTDAGTMSPFEHGEVFVLDDGGE + R ++ +L R +++ KI Y Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEADLDLGNYER---FLDIKLTRDNNITTGKIYRY 96 Query: 373 YNDYSRK 353 D RK Sbjct: 97 VIDKERK 103 >XP_009420685.1 PREDICTED: CTP synthase isoform X3 [Musa acuminata subsp. malaccensis] Length = 629 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 553 DPYLNTDAGTMSPFEHGEVFVLDDGGEVFF 464 DPYLNTDAGTMSPFEHGEVFVLDDGGEV F Sbjct: 40 DPYLNTDAGTMSPFEHGEVFVLDDGGEVDF 69