BLASTX nr result
ID: Panax25_contig00010437
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00010437 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017226068.1 PREDICTED: putative F-box protein At3g16210 [Dauc... 82 5e-16 >XP_017226068.1 PREDICTED: putative F-box protein At3g16210 [Daucus carota subsp. sativus] XP_017226070.1 PREDICTED: putative F-box protein At3g16210 [Daucus carota subsp. sativus] XP_017226071.1 PREDICTED: putative F-box protein At3g16210 [Daucus carota subsp. sativus] XP_017226072.1 PREDICTED: putative F-box protein At3g16210 [Daucus carota subsp. sativus] KZM83246.1 hypothetical protein DCAR_030815 [Daucus carota subsp. sativus] Length = 368 Score = 82.0 bits (201), Expect = 5e-16 Identities = 40/63 (63%), Positives = 51/63 (80%) Frame = -2 Query: 191 VPNKVRSLQDIPKEIIRLILLCLPMKSLLNLRCVSKSWCSFVNLHLKRRIVFLPFSKERL 12 V N SLQ IPKE+++ ILL +P+K LLNLRCV+KS+CS VN HLKR+I+FLP SKE+L Sbjct: 6 VCNAPLSLQSIPKEMLKEILLLIPVKCLLNLRCVNKSFCSLVNTHLKRQILFLPCSKEQL 65 Query: 11 VNN 3 +N Sbjct: 66 ADN 68