BLASTX nr result
ID: Panax25_contig00010354
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00010354 (678 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN00435.1 Conserved oligomeric Golgi complex subunit 8 [Glycine... 100 1e-20 XP_003520082.1 PREDICTED: conserved oligomeric Golgi complex sub... 100 1e-20 KHN35561.1 Conserved oligomeric Golgi complex subunit 8 [Glycine... 100 1e-20 XP_009598491.1 PREDICTED: conserved oligomeric Golgi complex sub... 91 4e-20 KZN10483.1 hypothetical protein DCAR_003139 [Daucus carota subsp... 97 9e-20 XP_014510649.1 PREDICTED: conserved oligomeric Golgi complex sub... 97 9e-20 XP_017229909.1 PREDICTED: conserved oligomeric Golgi complex sub... 97 9e-20 XP_017412158.1 PREDICTED: conserved oligomeric Golgi complex sub... 97 1e-19 XP_007156214.1 hypothetical protein PHAVU_003G267800g [Phaseolus... 97 1e-19 XP_014624624.1 PREDICTED: LOW QUALITY PROTEIN: conserved oligome... 96 2e-19 XP_016182072.1 PREDICTED: uncharacterized protein LOC107624124 i... 87 5e-19 XP_016182071.1 PREDICTED: conserved oligomeric Golgi complex sub... 88 6e-19 EYU46473.1 hypothetical protein MIMGU_mgv1a003974mg [Erythranthe... 94 2e-18 XP_012831380.1 PREDICTED: conserved oligomeric Golgi complex sub... 94 2e-18 KYP74688.1 hypothetical protein KK1_007378 [Cajanus cajan] 92 6e-18 XP_016435010.1 PREDICTED: conserved oligomeric Golgi complex sub... 92 7e-18 XP_016435009.1 PREDICTED: conserved oligomeric Golgi complex sub... 92 9e-18 XP_019258369.1 PREDICTED: conserved oligomeric Golgi complex sub... 91 1e-17 XP_016510252.1 PREDICTED: conserved oligomeric Golgi complex sub... 91 1e-17 XP_009781237.1 PREDICTED: conserved oligomeric Golgi complex sub... 91 1e-17 >KHN00435.1 Conserved oligomeric Golgi complex subunit 8 [Glycine soja] Length = 580 Score = 99.8 bits (247), Expect = 1e-20 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLPGVGFSA++ GDENHEDVT PSNLMEHPPLAVF+NG+ Sbjct: 362 NFQLVLDSHRWVPLPGVGFSAHTVGDENHEDVTPPSNLMEHPPLAVFINGV 412 >XP_003520082.1 PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Glycine max] KRH69706.1 hypothetical protein GLYMA_02G043400 [Glycine max] Length = 580 Score = 99.8 bits (247), Expect = 1e-20 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLPGVGFSA++ GDENHEDVT PSNLMEHPPLAVF+NG+ Sbjct: 362 NFQLVLDSHRWVPLPGVGFSAHTVGDENHEDVTPPSNLMEHPPLAVFINGV 412 >KHN35561.1 Conserved oligomeric Golgi complex subunit 8 [Glycine soja] Length = 581 Score = 99.8 bits (247), Expect = 1e-20 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLPGVGFSA++ GDENHEDVT PSNLMEHPPLAVF+NG+ Sbjct: 367 NFQLVLDSHRWVPLPGVGFSAHTVGDENHEDVTPPSNLMEHPPLAVFINGV 417 >XP_009598491.1 PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Nicotiana tomentosiformis] Length = 117 Score = 91.3 bits (225), Expect = 4e-20 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGMQLFVILVLF 548 +FQLVLDSHRWVPLP VGF A+SFG+E+ EDVT PS+LMEHPPLAVFVNG +L L Sbjct: 36 NFQLVLDSHRWVPLPAVGFPASSFGEESQEDVTPPSSLMEHPPLAVFVNGTLCSSLLKLL 95 Query: 549 GR 554 R Sbjct: 96 LR 97 >KZN10483.1 hypothetical protein DCAR_003139 [Daucus carota subsp. sativus] Length = 572 Score = 97.4 bits (241), Expect = 9e-20 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGFSANSFGDEN EDVT P NLM+HPPLAVFVNG+ Sbjct: 358 NFQLVLDSHRWVPLPAVGFSANSFGDENQEDVTPPPNLMDHPPLAVFVNGV 408 >XP_014510649.1 PREDICTED: conserved oligomeric Golgi complex subunit 8 [Vigna radiata var. radiata] Length = 585 Score = 97.4 bits (241), Expect = 9e-20 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGFS +S GDENHEDVT PSNLMEHPPLAVF+NG+ Sbjct: 359 NFQLVLDSHRWVPLPAVGFSGSSIGDENHEDVTPPSNLMEHPPLAVFINGV 409 >XP_017229909.1 PREDICTED: conserved oligomeric Golgi complex subunit 8 [Daucus carota subsp. sativus] Length = 586 Score = 97.4 bits (241), Expect = 9e-20 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGFSANSFGDEN EDVT P NLM+HPPLAVFVNG+ Sbjct: 372 NFQLVLDSHRWVPLPAVGFSANSFGDENQEDVTPPPNLMDHPPLAVFVNGV 422 >XP_017412158.1 PREDICTED: conserved oligomeric Golgi complex subunit 8 [Vigna angularis] KOM32164.1 hypothetical protein LR48_Vigan01g172000 [Vigna angularis] BAT75334.1 hypothetical protein VIGAN_01317900 [Vigna angularis var. angularis] Length = 581 Score = 97.1 bits (240), Expect = 1e-19 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGFS +S GDENHEDVT PSNLMEHPPLAVF+NG+ Sbjct: 359 NFQLVLDSHRWVPLPAVGFSGSSVGDENHEDVTPPSNLMEHPPLAVFINGV 409 >XP_007156214.1 hypothetical protein PHAVU_003G267800g [Phaseolus vulgaris] ESW28208.1 hypothetical protein PHAVU_003G267800g [Phaseolus vulgaris] Length = 581 Score = 97.1 bits (240), Expect = 1e-19 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGFS +S GDENHEDVT PSNLMEHPPLAVF+NG+ Sbjct: 359 NFQLVLDSHRWVPLPAVGFSGSSVGDENHEDVTPPSNLMEHPPLAVFINGV 409 >XP_014624624.1 PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex subunit 8-like [Glycine max] Length = 576 Score = 96.3 bits (238), Expect = 2e-19 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLPGVGFSA++ GDENHEDVT PSNLME PPLAVF+NG+ Sbjct: 362 NFQLVLDSHRWVPLPGVGFSAHTVGDENHEDVTPPSNLMEXPPLAVFINGV 412 >XP_016182072.1 PREDICTED: uncharacterized protein LOC107624124 isoform X2 [Arachis ipaensis] Length = 79 Score = 87.4 bits (215), Expect = 5e-19 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNG 518 +FQLVLDSHRWVPLP VGF AN+ G+E+ EDVT PS LMEHPPLAVF+NG Sbjct: 7 NFQLVLDSHRWVPLPAVGFPANTVGEESQEDVTPPSYLMEHPPLAVFING 56 >XP_016182071.1 PREDICTED: conserved oligomeric Golgi complex subunit 8-like isoform X1 [Arachis ipaensis] Length = 97 Score = 87.8 bits (216), Expect = 6e-19 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGF AN+ G+E+ EDVT PS LMEHPPLAVF+NG+ Sbjct: 7 NFQLVLDSHRWVPLPAVGFPANTVGEESQEDVTPPSYLMEHPPLAVFINGV 57 >EYU46473.1 hypothetical protein MIMGU_mgv1a003974mg [Erythranthe guttata] Length = 551 Score = 93.6 bits (231), Expect = 2e-18 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGF ANSFG+E+ +DVT PSNLMEHPPLAVF+NG+ Sbjct: 330 NFQLVLDSHRWVPLPSVGFPANSFGEESQDDVTPPSNLMEHPPLAVFINGV 380 >XP_012831380.1 PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Erythranthe guttata] Length = 588 Score = 93.6 bits (231), Expect = 2e-18 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGF ANSFG+E+ +DVT PSNLMEHPPLAVF+NG+ Sbjct: 367 NFQLVLDSHRWVPLPSVGFPANSFGEESQDDVTPPSNLMEHPPLAVFINGV 417 >KYP74688.1 hypothetical protein KK1_007378 [Cajanus cajan] Length = 565 Score = 92.0 bits (227), Expect = 6e-18 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGFS+N+ GDE+ ED+T PSNLMEHPPLAVF+NG+ Sbjct: 350 NFQLVLDSHRWVPLPAVGFSSNTIGDESLEDITPPSNLMEHPPLAVFINGV 400 >XP_016435010.1 PREDICTED: conserved oligomeric Golgi complex subunit 8-like isoform X2 [Nicotiana tabacum] Length = 473 Score = 91.7 bits (226), Expect = 7e-18 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGMQL 527 +FQLVLDSHRWVPLP VGF A+SFG+E+ EDVT PS+LMEHPPLAVFVNG+ + Sbjct: 263 NFQLVLDSHRWVPLPAVGFPASSFGEESQEDVTPPSSLMEHPPLAVFVNGVSV 315 >XP_016435009.1 PREDICTED: conserved oligomeric Golgi complex subunit 8-like isoform X1 [Nicotiana tabacum] Length = 572 Score = 91.7 bits (226), Expect = 9e-18 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGMQL 527 +FQLVLDSHRWVPLP VGF A+SFG+E+ EDVT PS+LMEHPPLAVFVNG+ + Sbjct: 362 NFQLVLDSHRWVPLPAVGFPASSFGEESQEDVTPPSSLMEHPPLAVFVNGVSV 414 >XP_019258369.1 PREDICTED: conserved oligomeric Golgi complex subunit 8 [Nicotiana attenuata] OIT40588.1 hypothetical protein A4A49_00642 [Nicotiana attenuata] Length = 574 Score = 91.3 bits (225), Expect = 1e-17 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGF A+SFG+E+ EDVT PS+LMEHPPLAVFVNG+ Sbjct: 364 NFQLVLDSHRWVPLPAVGFPASSFGEESQEDVTPPSSLMEHPPLAVFVNGV 414 >XP_016510252.1 PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Nicotiana tabacum] Length = 574 Score = 91.3 bits (225), Expect = 1e-17 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGF A+SFG+E+ EDVT PS+LMEHPPLAVFVNG+ Sbjct: 364 NFQLVLDSHRWVPLPAVGFPASSFGEESQEDVTPPSSLMEHPPLAVFVNGV 414 >XP_009781237.1 PREDICTED: conserved oligomeric Golgi complex subunit 8 [Nicotiana sylvestris] Length = 574 Score = 91.3 bits (225), Expect = 1e-17 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +3 Query: 369 HFQLVLDSHRWVPLPGVGFSANSFGDENHEDVTHPSNLMEHPPLAVFVNGM 521 +FQLVLDSHRWVPLP VGF A+SFG+E+ EDVT PS+LMEHPPLAVFVNG+ Sbjct: 364 NFQLVLDSHRWVPLPAVGFPASSFGEESQEDVTPPSSLMEHPPLAVFVNGV 414