BLASTX nr result
ID: Panax25_contig00010225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00010225 (503 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017248560.1 PREDICTED: transcription initiation factor TFIID ... 93 5e-19 KZM97373.1 hypothetical protein DCAR_015265 [Daucus carota subsp... 93 5e-19 CAN63613.1 hypothetical protein VITISV_005881 [Vitis vinifera] 84 9e-18 XP_003631761.1 PREDICTED: transcription initiation factor TFIID ... 87 1e-16 XP_018839597.1 PREDICTED: transcription initiation factor TFIID ... 87 1e-16 XP_004145505.1 PREDICTED: transcription initiation factor TFIID ... 86 2e-16 XP_019157197.1 PREDICTED: transcription initiation factor TFIID ... 85 3e-16 XP_008452860.1 PREDICTED: transcription initiation factor TFIID ... 84 6e-16 GAV59947.1 WD40 domain-containing protein/TFIID_90kDa domain-con... 83 2e-15 XP_015877479.1 PREDICTED: transcription initiation factor TFIID ... 83 2e-15 XP_002515435.1 PREDICTED: transcription initiation factor TFIID ... 82 3e-15 XP_011082979.1 PREDICTED: transcription initiation factor TFIID ... 82 3e-15 XP_007225152.1 hypothetical protein PRUPE_ppa002437mg [Prunus pe... 82 3e-15 KZV57940.1 protein with unknown function [Dorcoceras hygrometricum] 82 3e-15 XP_008220685.1 PREDICTED: transcription initiation factor TFIID ... 81 7e-15 XP_008377658.1 PREDICTED: transcription initiation factor TFIID ... 81 1e-14 XP_011036669.1 PREDICTED: transcription initiation factor TFIID ... 80 1e-14 XP_002324907.2 hypothetical protein POPTR_0018s02430g [Populus t... 80 1e-14 XP_011036668.1 PREDICTED: transcription initiation factor TFIID ... 80 1e-14 XP_012076440.1 PREDICTED: transcription initiation factor TFIID ... 80 2e-14 >XP_017248560.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Daucus carota subsp. sativus] Length = 664 Score = 93.2 bits (230), Expect = 5e-19 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALSTNG*RY 333 S+ RVPK+EENK+G+TTNRLRSLKTLPTKSTPV+AL+FSRRNLLFAAG +S NG Y Sbjct: 608 STARVPKSEENKTGSTTNRLRSLKTLPTKSTPVHALKFSRRNLLFAAGPISANGSTY 664 >KZM97373.1 hypothetical protein DCAR_015265 [Daucus carota subsp. sativus] Length = 717 Score = 93.2 bits (230), Expect = 5e-19 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALSTNG*RY 333 S+ RVPK+EENK+G+TTNRLRSLKTLPTKSTPV+AL+FSRRNLLFAAG +S NG Y Sbjct: 661 STARVPKSEENKTGSTTNRLRSLKTLPTKSTPVHALKFSRRNLLFAAGPISANGSTY 717 >CAN63613.1 hypothetical protein VITISV_005881 [Vitis vinifera] Length = 118 Score = 83.6 bits (205), Expect = 9e-18 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALSTNG 342 +ST+VP++EENKSG T+ RLRSLKTL TKSTPVY+LRFSRRNLLFAAGALS +G Sbjct: 66 TSTKVPRSEENKSGNTS-RLRSLKTLXTKSTPVYSLRFSRRNLLFAAGALSKSG 118 >XP_003631761.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Vitis vinifera] CBI21070.3 unnamed protein product, partial [Vitis vinifera] Length = 676 Score = 86.7 bits (213), Expect = 1e-16 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALSTNG 342 +ST+VP++EENKSG T+ RLRSLKTLPTKSTPVY+LRFSRRNLLFAAGALS +G Sbjct: 624 TSTKVPRSEENKSGNTS-RLRSLKTLPTKSTPVYSLRFSRRNLLFAAGALSKSG 676 >XP_018839597.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Juglans regia] Length = 680 Score = 86.7 bits (213), Expect = 1e-16 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST+VP+TEENK G+T NRLRSLKTLPTKSTPVY+LRFSRRNLLFAAGALS Sbjct: 627 TSTKVPRTEENKGGST-NRLRSLKTLPTKSTPVYSLRFSRRNLLFAAGALS 676 >XP_004145505.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Cucumis sativus] KGN55438.1 hypothetical protein Csa_4G652030 [Cucumis sativus] Length = 674 Score = 85.9 bits (211), Expect = 2e-16 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALSTN 345 SST+ P+T+ENK+GT NRLRSLKTLPTKSTPVY+LRFSRRNLLFAAGALS N Sbjct: 619 SSTKPPRTDENKTGTP-NRLRSLKTLPTKSTPVYSLRFSRRNLLFAAGALSKN 670 >XP_019157197.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Ipomoea nil] Length = 681 Score = 85.1 bits (209), Expect = 3e-16 Identities = 43/51 (84%), Positives = 49/51 (96%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST++PK+EENKSG+T NRLRSLKTLPTKSTP+YALRFSRRNLLFAAGA S Sbjct: 629 TSTKMPKSEENKSGST-NRLRSLKTLPTKSTPLYALRFSRRNLLFAAGAFS 678 >XP_008452860.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Cucumis melo] Length = 674 Score = 84.3 bits (207), Expect = 6e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 SST+ P+T+ENK+GT NRLRSLKTLPTKSTPVY+LRFSRRNLLFAAGALS Sbjct: 619 SSTKPPRTDENKTGTA-NRLRSLKTLPTKSTPVYSLRFSRRNLLFAAGALS 668 >GAV59947.1 WD40 domain-containing protein/TFIID_90kDa domain-containing protein [Cephalotus follicularis] Length = 671 Score = 82.8 bits (203), Expect = 2e-15 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST+ P+TEENKS NRLR LKTLPTKSTPVYALRFSRRNLLFAAG LS Sbjct: 620 TSTKAPRTEENKSSGNINRLRLLKTLPTKSTPVYALRFSRRNLLFAAGVLS 670 >XP_015877479.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Ziziphus jujuba] Length = 679 Score = 82.8 bits (203), Expect = 2e-15 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST+V +TEENKSG T+ RLRSLKTLPTKSTPVY+LRFSRRNLLFAAGALS Sbjct: 627 TSTKVSRTEENKSGNTS-RLRSLKTLPTKSTPVYSLRFSRRNLLFAAGALS 676 >XP_002515435.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Ricinus communis] EEF46884.1 protein with unknown function [Ricinus communis] Length = 670 Score = 82.4 bits (202), Expect = 3e-15 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALSTNG 342 SST+V K EE+KSG+ NRLRSLKTLPTKSTPVY+LRFSRRNLLFAAG LS +G Sbjct: 618 SSTKVTKAEESKSGSA-NRLRSLKTLPTKSTPVYSLRFSRRNLLFAAGVLSKSG 670 >XP_011082979.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Sesamum indicum] Length = 671 Score = 82.4 bits (202), Expect = 3e-15 Identities = 42/51 (82%), Positives = 49/51 (96%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +S++VPKTEENKSG+ + RLRSLKTLPTKSTPVYAL+FSRRNLLFAAGAL+ Sbjct: 619 TSSKVPKTEENKSGSAS-RLRSLKTLPTKSTPVYALQFSRRNLLFAAGALT 668 >XP_007225152.1 hypothetical protein PRUPE_ppa002437mg [Prunus persica] ONI32902.1 hypothetical protein PRUPE_1G392800 [Prunus persica] ONI32903.1 hypothetical protein PRUPE_1G392800 [Prunus persica] Length = 673 Score = 82.4 bits (202), Expect = 3e-15 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST++PKTEENKSG T+ RLRSLKTLPTK TPVY+LRFSRRNLLFAAG LS Sbjct: 621 ASTKLPKTEENKSGNTS-RLRSLKTLPTKCTPVYSLRFSRRNLLFAAGVLS 670 >KZV57940.1 protein with unknown function [Dorcoceras hygrometricum] Length = 904 Score = 82.4 bits (202), Expect = 3e-15 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +S++V K EENKSG+T NRLRSLKTLPTKSTPVYAL+FSRRNLLFAAGALS Sbjct: 564 ASSKVAKNEENKSGST-NRLRSLKTLPTKSTPVYALQFSRRNLLFAAGALS 613 >XP_008220685.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Prunus mume] Length = 673 Score = 81.3 bits (199), Expect = 7e-15 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST++PKTEENKSG T+ RLRSLKTLPTK TPVY+LRFSRRNLLFAAG L+ Sbjct: 621 ASTKLPKTEENKSGNTS-RLRSLKTLPTKCTPVYSLRFSRRNLLFAAGVLA 670 >XP_008377658.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Malus domestica] Length = 675 Score = 80.9 bits (198), Expect = 1e-14 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST++P+TEENKSG T+ RLRSL+TLPTKSTPVY+LRFSRRNLLFA+G LS Sbjct: 623 ASTKLPRTEENKSGNTS-RLRSLRTLPTKSTPVYSLRFSRRNLLFASGVLS 672 >XP_011036669.1 PREDICTED: transcription initiation factor TFIID subunit 5-like isoform X2 [Populus euphratica] Length = 673 Score = 80.5 bits (197), Expect = 1e-14 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST+ P+TEE+KSG T NRLR LKTLPTKSTPVY LRFSRRNLLFAAGAL+ Sbjct: 621 TSTKAPRTEESKSGNT-NRLRLLKTLPTKSTPVYTLRFSRRNLLFAAGALA 670 >XP_002324907.2 hypothetical protein POPTR_0018s02430g [Populus trichocarpa] EEF03472.2 hypothetical protein POPTR_0018s02430g [Populus trichocarpa] Length = 675 Score = 80.5 bits (197), Expect = 1e-14 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST+ P+TEE+KSG T NRLR LKTLPTKSTPVY LRFSRRNLLFAAGAL+ Sbjct: 623 TSTKAPRTEESKSGNT-NRLRLLKTLPTKSTPVYTLRFSRRNLLFAAGALA 672 >XP_011036668.1 PREDICTED: transcription initiation factor TFIID subunit 5-like isoform X1 [Populus euphratica] Length = 676 Score = 80.5 bits (197), Expect = 1e-14 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 +ST+ P+TEE+KSG T NRLR LKTLPTKSTPVY LRFSRRNLLFAAGAL+ Sbjct: 624 TSTKAPRTEESKSGNT-NRLRLLKTLPTKSTPVYTLRFSRRNLLFAAGALA 673 >XP_012076440.1 PREDICTED: transcription initiation factor TFIID subunit 5 [Jatropha curcas] KDP33523.1 hypothetical protein JCGZ_07094 [Jatropha curcas] Length = 670 Score = 80.1 bits (196), Expect = 2e-14 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -1 Query: 503 SSTRVPKTEENKSGTTTNRLRSLKTLPTKSTPVYALRFSRRNLLFAAGALS 351 SST+VP+ E++KSGT NRLRSLKTLPTK TPVY LRFSRRNLLFAAG LS Sbjct: 618 SSTKVPRAEDSKSGTA-NRLRSLKTLPTKMTPVYTLRFSRRNLLFAAGVLS 667