BLASTX nr result
ID: Panax25_contig00010189
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00010189 (528 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACJ83732.1 unknown, partial [Medicago truncatula] 62 2e-09 XP_013465165.1 prohibitin complex protein [Medicago truncatula] ... 64 4e-09 AFK41771.1 unknown [Medicago truncatula] 64 4e-09 XP_017248375.1 PREDICTED: prohibitin-1, mitochondrial [Daucus ca... 63 1e-08 XP_015899444.1 PREDICTED: prohibitin-1, mitochondrial [Ziziphus ... 63 1e-08 XP_007149798.1 hypothetical protein PHAVU_005G099600g [Phaseolus... 62 2e-08 XP_016171151.1 PREDICTED: prohibitin-1, mitochondrial isoform X2... 62 4e-08 XP_009376557.1 PREDICTED: prohibitin-1, mitochondrial-like [Pyru... 61 5e-08 XP_008381849.1 PREDICTED: prohibitin-1, mitochondrial-like [Malu... 61 5e-08 AFK40411.1 unknown [Lotus japonicus] 61 5e-08 XP_008372742.1 PREDICTED: prohibitin-1, mitochondrial [Malus dom... 61 5e-08 KYP53345.1 Prohibitin-2 [Cajanus cajan] 61 5e-08 XP_016187924.1 PREDICTED: prohibitin-1, mitochondrial-like [Arac... 61 7e-08 XP_019432140.1 PREDICTED: prohibitin-1, mitochondrial-like [Lupi... 61 7e-08 XP_019431334.1 PREDICTED: prohibitin-1, mitochondrial [Lupinus a... 61 7e-08 KHN43644.1 Prohibitin-2 [Glycine soja] KRH39037.1 hypothetical p... 61 7e-08 XP_009339462.1 PREDICTED: prohibitin-1, mitochondrial [Pyrus x b... 61 7e-08 NP_001242309.1 uncharacterized protein LOC100806763 [Glycine max... 61 7e-08 KHN27917.1 Prohibitin-2 [Glycine soja] 61 8e-08 XP_006592856.1 PREDICTED: prohibitin-1, mitochondrial-like [Glyc... 61 8e-08 >ACJ83732.1 unknown, partial [Medicago truncatula] Length = 97 Score = 61.6 bits (148), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQG 421 ITLRKIEAAREIAHV++N+ANK YL +GDLLLN+QG Sbjct: 62 ITLRKIEAAREIAHVIANSANKVYLEAGDLLLNLQG 97 >XP_013465165.1 prohibitin complex protein [Medicago truncatula] KEH39200.1 prohibitin complex protein [Medicago truncatula] Length = 287 Score = 64.3 bits (155), Expect = 4e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVDSSSNK 400 ITLRKIEAAREIAHV++N+ANK YL +GDLLLN+QG++ +K Sbjct: 244 ITLRKIEAAREIAHVIANSANKVYLEAGDLLLNLQGINLDPSK 286 >AFK41771.1 unknown [Medicago truncatula] Length = 287 Score = 64.3 bits (155), Expect = 4e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVDSSSNK 400 ITLRKIEAAREIAHV++N+ANK YL +GDLLLN+QG++ +K Sbjct: 244 ITLRKIEAAREIAHVIANSANKVYLEAGDLLLNLQGINLDPSK 286 >XP_017248375.1 PREDICTED: prohibitin-1, mitochondrial [Daucus carota subsp. sativus] KZM99592.1 hypothetical protein DCAR_013046 [Daucus carota subsp. sativus] Length = 288 Score = 63.2 bits (152), Expect = 1e-08 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVDSSSNK 400 ITLRKIEAAREIA+VM++ NKTYLNSGDLLLN+ G+D + K Sbjct: 246 ITLRKIEAAREIANVMASGNNKTYLNSGDLLLNLHGMDVTPGK 288 >XP_015899444.1 PREDICTED: prohibitin-1, mitochondrial [Ziziphus jujuba] XP_015899448.1 PREDICTED: prohibitin-1, mitochondrial [Ziziphus jujuba] XP_015899456.1 PREDICTED: prohibitin-1, mitochondrial [Ziziphus jujuba] Length = 290 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVD 415 I LRKIEAAREIAH ++N+ANK +LNSGDLLLN+QG+D Sbjct: 246 IALRKIEAAREIAHTIANSANKAFLNSGDLLLNLQGMD 283 >XP_007149798.1 hypothetical protein PHAVU_005G099600g [Phaseolus vulgaris] ESW21792.1 hypothetical protein PHAVU_005G099600g [Phaseolus vulgaris] Length = 289 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVDSSSNK 400 ITLRKIEAAREIAH +SN+ANK YLNS DLLLN+Q +D +K Sbjct: 246 ITLRKIEAAREIAHTISNSANKAYLNSEDLLLNLQKMDLEPSK 288 >XP_016171151.1 PREDICTED: prohibitin-1, mitochondrial isoform X2 [Arachis ipaensis] Length = 292 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVDSSSNK 400 ITLRKIEAAREIA+ +SNAANK YLNS DLLLN+QG+ +K Sbjct: 249 ITLRKIEAAREIANTVSNAANKVYLNSDDLLLNLQGMKLEPSK 291 >XP_009376557.1 PREDICTED: prohibitin-1, mitochondrial-like [Pyrus x bretschneideri] Length = 288 Score = 61.2 bits (147), Expect = 5e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVDSSSNK*K 394 ITLRKIEAAREIAH +SN+ANK +LNS DLLLN+Q ++ NK K Sbjct: 244 ITLRKIEAAREIAHTISNSANKVFLNSDDLLLNLQEMNLDINKKK 288 >XP_008381849.1 PREDICTED: prohibitin-1, mitochondrial-like [Malus domestica] XP_008358298.1 PREDICTED: prohibitin-1, mitochondrial [Malus domestica] Length = 288 Score = 61.2 bits (147), Expect = 5e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVDSSSNK*K 394 ITLRKIEAAREIAH +SN+ANK +LNS DLLLN+Q ++ NK K Sbjct: 244 ITLRKIEAAREIAHTISNSANKVFLNSDDLLLNLQEMNLDINKKK 288 >AFK40411.1 unknown [Lotus japonicus] Length = 289 Score = 61.2 bits (147), Expect = 5e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGV 418 ITLR+IEAAREIAH +SN+ANK YLNS DLLLN+QG+ Sbjct: 245 ITLRRIEAAREIAHTISNSANKVYLNSDDLLLNLQGL 281 >XP_008372742.1 PREDICTED: prohibitin-1, mitochondrial [Malus domestica] Length = 290 Score = 61.2 bits (147), Expect = 5e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVDSSSNK*K 394 ITLRKIEAAREIAH +SN+ANK +LNS DLLLN+Q ++ NK K Sbjct: 246 ITLRKIEAAREIAHTISNSANKVFLNSDDLLLNLQEMNLDVNKKK 290 >KYP53345.1 Prohibitin-2 [Cajanus cajan] Length = 291 Score = 61.2 bits (147), Expect = 5e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQ 424 ITLRKIEAAREIAH +SNAANK YLNS DLLLN+Q Sbjct: 248 ITLRKIEAAREIAHTISNAANKVYLNSADLLLNLQ 282 >XP_016187924.1 PREDICTED: prohibitin-1, mitochondrial-like [Arachis ipaensis] XP_016187925.1 PREDICTED: prohibitin-1, mitochondrial-like [Arachis ipaensis] Length = 287 Score = 60.8 bits (146), Expect = 7e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQ 424 ITLRKIEAAREIAH +SNAANK YLNS DLLLN+Q Sbjct: 243 ITLRKIEAAREIAHTISNAANKVYLNSDDLLLNLQ 277 >XP_019432140.1 PREDICTED: prohibitin-1, mitochondrial-like [Lupinus angustifolius] XP_019432141.1 PREDICTED: prohibitin-1, mitochondrial-like [Lupinus angustifolius] XP_019432142.1 PREDICTED: prohibitin-1, mitochondrial-like [Lupinus angustifolius] OIW21004.1 hypothetical protein TanjilG_27349 [Lupinus angustifolius] Length = 289 Score = 60.8 bits (146), Expect = 7e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQ 424 ITLRKIEAAREIAH +SNAANK YLNS DLLLN+Q Sbjct: 246 ITLRKIEAAREIAHTISNAANKVYLNSDDLLLNLQ 280 >XP_019431334.1 PREDICTED: prohibitin-1, mitochondrial [Lupinus angustifolius] XP_019431335.1 PREDICTED: prohibitin-1, mitochondrial [Lupinus angustifolius] XP_019431336.1 PREDICTED: prohibitin-1, mitochondrial [Lupinus angustifolius] OIW20574.1 hypothetical protein TanjilG_15379 [Lupinus angustifolius] Length = 289 Score = 60.8 bits (146), Expect = 7e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQ 424 ITLRKIEAAREIAH +SNAANK YLNS DLLLN+Q Sbjct: 246 ITLRKIEAAREIAHTISNAANKVYLNSDDLLLNLQ 280 >KHN43644.1 Prohibitin-2 [Glycine soja] KRH39037.1 hypothetical protein GLYMA_09G173500 [Glycine max] Length = 289 Score = 60.8 bits (146), Expect = 7e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQ 424 ITLRKIEAAREIAH +SNAANK YLNS DLLLN+Q Sbjct: 246 ITLRKIEAAREIAHTISNAANKVYLNSDDLLLNLQ 280 >XP_009339462.1 PREDICTED: prohibitin-1, mitochondrial [Pyrus x bretschneideri] Length = 289 Score = 60.8 bits (146), Expect = 7e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQGVDSSSNK 400 ITLRKIEAAREIAH +SN+ANK +LNS DLLLN+Q ++ NK Sbjct: 246 ITLRKIEAAREIAHTISNSANKVFLNSDDLLLNLQEMNLDINK 288 >NP_001242309.1 uncharacterized protein LOC100806763 [Glycine max] ACU21146.1 unknown [Glycine max] Length = 289 Score = 60.8 bits (146), Expect = 7e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQ 424 ITLRKIEAAREIAH +SNAANK YLNS DLLLN+Q Sbjct: 246 ITLRKIEAAREIAHTISNAANKVYLNSDDLLLNLQ 280 >KHN27917.1 Prohibitin-2 [Glycine soja] Length = 336 Score = 60.8 bits (146), Expect = 8e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQ 424 ITLRKIEAAREIAH +SNAANK YLNS DLLLN+Q Sbjct: 293 ITLRKIEAAREIAHTISNAANKVYLNSDDLLLNLQ 327 >XP_006592856.1 PREDICTED: prohibitin-1, mitochondrial-like [Glycine max] KRH26997.1 hypothetical protein GLYMA_12G207500 [Glycine max] Length = 336 Score = 60.8 bits (146), Expect = 8e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 528 ITLRKIEAAREIAHVMSNAANKTYLNSGDLLLNVQ 424 ITLRKIEAAREIAH +SNAANK YLNS DLLLN+Q Sbjct: 293 ITLRKIEAAREIAHTISNAANKVYLNSDDLLLNLQ 327