BLASTX nr result
ID: Panax25_contig00009887
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00009887 (668 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247167.1 PREDICTED: protein CLT2, chloroplastic [Daucus ca... 59 1e-06 KZM99787.1 hypothetical protein DCAR_012851 [Daucus carota subsp... 59 1e-06 XP_017237238.1 PREDICTED: uncharacterized protein LOC108210461 [... 58 2e-06 >XP_017247167.1 PREDICTED: protein CLT2, chloroplastic [Daucus carota subsp. sativus] Length = 430 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 527 IEMTFLLWQLAFSTILLGRRYSLNKIVGCLL 619 + TFLLWQLAFSTILLGRRYSLNKI GCLL Sbjct: 193 LNQTFLLWQLAFSTILLGRRYSLNKIAGCLL 223 >KZM99787.1 hypothetical protein DCAR_012851 [Daucus carota subsp. sativus] Length = 768 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 527 IEMTFLLWQLAFSTILLGRRYSLNKIVGCLL 619 + TFLLWQLAFSTILLGRRYSLNKI GCLL Sbjct: 193 LNQTFLLWQLAFSTILLGRRYSLNKIAGCLL 223 >XP_017237238.1 PREDICTED: uncharacterized protein LOC108210461 [Daucus carota subsp. sativus] KZN02122.1 hypothetical protein DCAR_010876 [Daucus carota subsp. sativus] Length = 351 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +1 Query: 298 IIVQSGDAKIADHTSFIKDVAVTEPPKHLQHLLRMLQVR 414 + + S D+K+ADH SFIKDVA +PP++LQHLLRMLQVR Sbjct: 35 VALPSEDSKVADHLSFIKDVAAAKPPENLQHLLRMLQVR 73