BLASTX nr result
ID: Panax25_contig00009759
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00009759 (600 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007223537.1 hypothetical protein PRUPE_ppa014503mg [Prunus pe... 53 2e-06 KZN06811.1 hypothetical protein DCAR_007648 [Daucus carota subsp... 52 6e-06 >XP_007223537.1 hypothetical protein PRUPE_ppa014503mg [Prunus persica] ONI33291.1 hypothetical protein PRUPE_1G415300 [Prunus persica] Length = 66 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = +3 Query: 195 MAVSHPTATLIALMAVIATVFSLVGTSIASDAPAPSPTSLAGSVSPS 335 MAVS T+ L+ALMAV TV S++G + A+++PAPSPTS + S+SPS Sbjct: 1 MAVSKATS-LVALMAVFVTVLSVIGAAQAAESPAPSPTSASASISPS 46 >KZN06811.1 hypothetical protein DCAR_007648 [Daucus carota subsp. sativus] Length = 63 Score = 52.0 bits (123), Expect = 6e-06 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = +3 Query: 210 PTATLIALMAVIATVFSLVGTSIASDAPAPSPTSLAGSVSPS 335 P+A+ + L +VIA V +LVG++ ++DAPAPSPTS AGSVSPS Sbjct: 4 PSASFVTL-SVIAVVLALVGSAFSADAPAPSPTSSAGSVSPS 44