BLASTX nr result
ID: Panax25_contig00009303
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00009303 (829 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018854108.1 PREDICTED: 40S ribosomal protein S23-like, partia... 69 3e-11 XP_016451136.1 PREDICTED: 40S ribosomal protein S23-like [Nicoti... 67 2e-10 KCW49695.1 hypothetical protein EUGRSUZ_K03200 [Eucalyptus grandis] 67 2e-10 KCW49693.1 hypothetical protein EUGRSUZ_K03200 [Eucalyptus grandis] 67 3e-10 XP_016492356.1 PREDICTED: 40S ribosomal protein S23-like, partia... 67 3e-10 KCW49709.1 hypothetical protein EUGRSUZ_K03211 [Eucalyptus grandis] 67 3e-10 XP_016477679.1 PREDICTED: 40S ribosomal protein S23-like [Nicoti... 67 4e-10 NP_001274976.1 uncharacterized protein LOC102577739 [Solanum tub... 67 4e-10 ERN04913.1 hypothetical protein AMTR_s00080p00080700 [Amborella ... 66 8e-10 CDP06706.1 unnamed protein product [Coffea canephora] 67 9e-10 KZV51763.1 hypothetical protein F511_11451, partial [Dorcoceras ... 65 1e-09 XP_004137806.1 PREDICTED: 40S ribosomal protein S23 [Cucumis sat... 65 1e-09 ACG45022.1 hypothetical protein [Zea mays] ACG47889.1 hypothetic... 62 1e-09 KVI00004.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var... 65 2e-09 ONM36622.1 40S ribosomal protein S23-2 [Zea mays] 62 2e-09 KVI09540.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var... 65 2e-09 KNA06967.1 hypothetical protein SOVF_176220 [Spinacia oleracea] ... 64 3e-09 XP_012073769.1 PREDICTED: 40S ribosomal protein S23-like [Jatrop... 64 3e-09 XP_006845010.2 PREDICTED: 40S ribosomal protein S23 [Amborella t... 64 3e-09 XP_010669684.1 PREDICTED: 40S ribosomal protein S23 [Beta vulgar... 64 3e-09 >XP_018854108.1 PREDICTED: 40S ribosomal protein S23-like, partial [Juglans regia] Length = 103 Score = 68.6 bits (166), Expect = 3e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 735 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 4 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHL 34 >XP_016451136.1 PREDICTED: 40S ribosomal protein S23-like [Nicotiana tabacum] Length = 116 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 32 >KCW49695.1 hypothetical protein EUGRSUZ_K03200 [Eucalyptus grandis] Length = 116 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 32 >KCW49693.1 hypothetical protein EUGRSUZ_K03200 [Eucalyptus grandis] Length = 131 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 32 >XP_016492356.1 PREDICTED: 40S ribosomal protein S23-like, partial [Nicotiana tabacum] Length = 132 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 32 >KCW49709.1 hypothetical protein EUGRSUZ_K03211 [Eucalyptus grandis] Length = 133 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 32 >XP_016477679.1 PREDICTED: 40S ribosomal protein S23-like [Nicotiana tabacum] Length = 142 Score = 66.6 bits (161), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 32 >NP_001274976.1 uncharacterized protein LOC102577739 [Solanum tuberosum] XP_004246693.1 PREDICTED: 40S ribosomal protein S23 [Solanum lycopersicum] XP_004249503.1 PREDICTED: 40S ribosomal protein S23 [Solanum lycopersicum] XP_004249676.1 PREDICTED: 40S ribosomal protein S23 [Solanum lycopersicum] XP_006339059.1 PREDICTED: 40S ribosomal protein S23 [Solanum tuberosum] XP_006361778.1 PREDICTED: 40S ribosomal protein S23 [Solanum tuberosum] XP_006363678.1 PREDICTED: 40S ribosomal protein S23 [Solanum tuberosum] XP_006424658.1 hypothetical protein CICLE_v10029532mg [Citrus clementina] XP_006488186.1 PREDICTED: 40S ribosomal protein S23 [Citrus sinensis] XP_009609409.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tomentosiformis] XP_009622195.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tomentosiformis] XP_009608287.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tomentosiformis] XP_009590383.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tomentosiformis] XP_009782068.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana sylvestris] XP_009797647.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana sylvestris] XP_009764738.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana sylvestris] XP_009772658.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana sylvestris] XP_010037913.1 PREDICTED: 40S ribosomal protein S23 [Eucalyptus grandis] XP_010037934.1 PREDICTED: 40S ribosomal protein S23 [Eucalyptus grandis] XP_012831938.1 PREDICTED: 40S ribosomal protein S23 [Erythranthe guttata] XP_012835991.1 PREDICTED: 40S ribosomal protein S23 [Erythranthe guttata] XP_012846480.1 PREDICTED: 40S ribosomal protein S23 [Erythranthe guttata] XP_015088332.1 PREDICTED: 40S ribosomal protein S23 [Solanum pennellii] XP_015088922.1 PREDICTED: 40S ribosomal protein S23 [Solanum pennellii] XP_015089074.1 PREDICTED: 40S ribosomal protein S23 [Solanum pennellii] XP_016493532.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tabacum] XP_016493534.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tabacum] XP_016494627.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tabacum] XP_016497343.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tabacum] XP_016498165.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tabacum] XP_016514411.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tabacum] XP_016514412.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tabacum] XP_016514413.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana tabacum] XP_016575790.1 PREDICTED: 40S ribosomal protein S23 [Capsicum annuum] XP_016542663.1 PREDICTED: 40S ribosomal protein S23 [Capsicum annuum] XP_016543093.1 PREDICTED: 40S ribosomal protein S23 [Capsicum annuum] XP_016543352.1 PREDICTED: 40S ribosomal protein S23 [Capsicum annuum] XP_017244893.1 PREDICTED: 40S ribosomal protein S23 [Daucus carota subsp. sativus] XP_017249842.1 PREDICTED: 40S ribosomal protein S23 [Daucus carota subsp. sativus] XP_017255089.1 PREDICTED: 40S ribosomal protein S23 [Daucus carota subsp. sativus] XP_018836480.1 PREDICTED: 40S ribosomal protein S23 [Juglans regia] XP_018858681.1 PREDICTED: 40S ribosomal protein S23 [Juglans regia] XP_018824484.1 PREDICTED: 40S ribosomal protein S23 [Juglans regia] XP_018832209.1 PREDICTED: 40S ribosomal protein S23 [Juglans regia] XP_019263599.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana attenuata] XP_019250627.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana attenuata] XP_019251932.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana attenuata] XP_019254735.1 PREDICTED: 40S ribosomal protein S23 [Nicotiana attenuata] ABB16993.1 unknown [Solanum tuberosum] ESR37898.1 hypothetical protein CICLE_v10029532mg [Citrus clementina] EYU29808.1 hypothetical protein MIMGU_mgv1a015865mg [Erythranthe guttata] EYU38513.1 hypothetical protein MIMGU_mgv1a015878mg [Erythranthe guttata] EYU41645.1 hypothetical protein MIMGU_mgv1a015866mg [Erythranthe guttata] KCW49694.1 hypothetical protein EUGRSUZ_K03200 [Eucalyptus grandis] KCW49710.1 hypothetical protein EUGRSUZ_K03211 [Eucalyptus grandis] KZM97675.1 hypothetical protein DCAR_014963 [Daucus carota subsp. sativus] OIS98051.1 40s ribosomal protein s23 [Nicotiana attenuata] OIS99232.1 40s ribosomal protein s23 [Nicotiana attenuata] OIT01293.1 40s ribosomal protein s23 [Nicotiana attenuata] OIT37029.1 40s ribosomal protein s23 [Nicotiana attenuata] Length = 142 Score = 66.6 bits (161), Expect = 4e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 32 >ERN04913.1 hypothetical protein AMTR_s00080p00080700 [Amborella trichopoda] Length = 159 Score = 66.2 bits (160), Expect = 8e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 735 RKTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 RKTRGMGAGRKLK+HRRRQ+WADKSYKKSHL Sbjct: 19 RKTRGMGAGRKLKTHRRRQKWADKSYKKSHL 49 >CDP06706.1 unnamed protein product [Coffea canephora] Length = 183 Score = 66.6 bits (161), Expect = 9e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 44 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 73 >KZV51763.1 hypothetical protein F511_11451, partial [Dorcoceras hygrometricum] Length = 140 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADK+YKKSHL Sbjct: 1 KTRGMGAGRKLKSHRRRQRWADKAYKKSHL 30 >XP_004137806.1 PREDICTED: 40S ribosomal protein S23 [Cucumis sativus] XP_004143809.1 PREDICTED: 40S ribosomal protein S23 [Cucumis sativus] XP_004149560.1 PREDICTED: 40S ribosomal protein S23 [Cucumis sativus] XP_008442648.1 PREDICTED: 40S ribosomal protein S23 [Cucumis melo] XP_008463567.1 PREDICTED: 40S ribosomal protein S23 [Cucumis melo] XP_008463898.1 PREDICTED: 40S ribosomal protein S23 [Cucumis melo] XP_010253521.1 PREDICTED: 40S ribosomal protein S23 [Nelumbo nucifera] XP_010244979.1 PREDICTED: 40S ribosomal protein S23 [Nelumbo nucifera] XP_011077380.1 PREDICTED: 40S ribosomal protein S23 [Sesamum indicum] XP_011094704.1 PREDICTED: 40S ribosomal protein S23 [Sesamum indicum] XP_011094750.1 PREDICTED: 40S ribosomal protein S23 [Sesamum indicum] XP_015874365.1 PREDICTED: 40S ribosomal protein S23 [Ziziphus jujuba] XP_015871640.1 PREDICTED: 40S ribosomal protein S23 [Ziziphus jujuba] XP_019199308.1 PREDICTED: 40S ribosomal protein S23 [Ipomoea nil] XP_019159119.1 PREDICTED: 40S ribosomal protein S23 [Ipomoea nil] KGN47293.1 hypothetical protein Csa_6G289760 [Cucumis sativus] KGN51234.1 hypothetical protein Csa_5G496500 [Cucumis sativus] Length = 142 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLKSHRRRQRWADK+YKKSHL Sbjct: 3 KTRGMGAGRKLKSHRRRQRWADKAYKKSHL 32 >ACG45022.1 hypothetical protein [Zea mays] ACG47889.1 hypothetical protein [Zea mays] Length = 44 Score = 62.4 bits (150), Expect = 1e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLK+HRR QRWADK+YKKSHL Sbjct: 3 KTRGMGAGRKLKTHRRNQRWADKAYKKSHL 32 >KVI00004.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var. scolymus] Length = 129 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KT GMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTHGMGAGRKLKSHRRRQRWADKSYKKSHL 32 >ONM36622.1 40S ribosomal protein S23-2 [Zea mays] Length = 54 Score = 62.4 bits (150), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLK+HRR QRWADK+YKKSHL Sbjct: 3 KTRGMGAGRKLKTHRRNQRWADKAYKKSHL 32 >KVI09540.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var. scolymus] Length = 142 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KT GMGAGRKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTHGMGAGRKLKSHRRRQRWADKSYKKSHL 32 >KNA06967.1 hypothetical protein SOVF_176220 [Spinacia oleracea] KNA19310.1 hypothetical protein SOVF_062920 [Spinacia oleracea] Length = 142 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGA RKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTRGMGAARKLKSHRRRQRWADKSYKKSHL 32 >XP_012073769.1 PREDICTED: 40S ribosomal protein S23-like [Jatropha curcas] Length = 142 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKL+SHRRRQRWADK+YKKSHL Sbjct: 3 KTRGMGAGRKLRSHRRRQRWADKAYKKSHL 32 >XP_006845010.2 PREDICTED: 40S ribosomal protein S23 [Amborella trichopoda] XP_011622926.1 PREDICTED: 40S ribosomal protein S23 [Amborella trichopoda] Length = 142 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGAGRKLK+HRRRQ+WADKSYKKSHL Sbjct: 3 KTRGMGAGRKLKTHRRRQKWADKSYKKSHL 32 >XP_010669684.1 PREDICTED: 40S ribosomal protein S23 [Beta vulgaris subsp. vulgaris] XP_010667239.1 PREDICTED: 40S ribosomal protein S23 [Beta vulgaris subsp. vulgaris] KMS95515.1 hypothetical protein BVRB_007550 [Beta vulgaris subsp. vulgaris] KMT17718.1 hypothetical protein BVRB_2g036630 [Beta vulgaris subsp. vulgaris] Length = 142 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 738 KTRGMGAGRKLKSHRRRQRWADKSYKKSHL 827 KTRGMGA RKLKSHRRRQRWADKSYKKSHL Sbjct: 3 KTRGMGAARKLKSHRRRQRWADKSYKKSHL 32