BLASTX nr result
ID: Panax25_contig00009072
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00009072 (1313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019236265.1 PREDICTED: uncharacterized protein LOC109216556 [... 59 4e-06 >XP_019236265.1 PREDICTED: uncharacterized protein LOC109216556 [Nicotiana attenuata] Length = 298 Score = 59.3 bits (142), Expect = 4e-06 Identities = 27/69 (39%), Positives = 41/69 (59%) Frame = -1 Query: 1259 CTCDYVCGNAILQAKDDNIIKVSQFLMGLNPQFSVVRSQILLMPILPSLNEAYAPVTRGG 1080 CTCD CG + K ++ QFLMGLN ++ RS +LL+ +LPSL+ AY+ + R Sbjct: 138 CTCDCSCGGKLKNYKSQQDSRLIQFLMGLNDTYAAARSNLLLLSLLPSLSHAYSLLIRDE 197 Query: 1079 TKAMCYVSH 1053 + ++SH Sbjct: 198 KQREVHISH 206