BLASTX nr result
ID: Panax25_contig00008480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00008480 (783 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010538733.1 PREDICTED: Niemann-Pick C1 protein-like [Tarenaya... 64 7e-09 XP_010242906.1 PREDICTED: Niemann-Pick C1 protein-like [Nelumbo ... 66 1e-08 XP_019054366.1 PREDICTED: Niemann-Pick C1 protein-like isoform X... 66 1e-08 XP_019054365.1 PREDICTED: Niemann-Pick C1 protein-like isoform X... 66 1e-08 KGN46670.1 hypothetical protein Csa_6G120400 [Cucumis sativus] 63 2e-08 XP_018836419.1 PREDICTED: Niemann-Pick C1 protein-like isoform X... 65 2e-08 OMO50471.1 Patched [Corchorus capsularis] 65 2e-08 XP_016707676.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypiu... 65 2e-08 XP_016702902.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypiu... 65 2e-08 XP_012464596.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypiu... 65 2e-08 XP_017642001.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypiu... 65 2e-08 XP_018836418.1 PREDICTED: Niemann-Pick C1 protein-like isoform X... 65 2e-08 XP_011627546.1 PREDICTED: Niemann-Pick C1 protein [Amborella tri... 65 3e-08 OAY22513.1 hypothetical protein MANES_18G004200 [Manihot esculenta] 65 3e-08 OAY50377.1 hypothetical protein MANES_05G130900 [Manihot esculenta] 65 3e-08 ERN17219.1 hypothetical protein AMTR_s00044p00170650 [Amborella ... 65 3e-08 XP_010094557.1 Niemann-Pick C1 protein [Morus notabilis] EXB5631... 65 3e-08 CAN75892.1 hypothetical protein VITISV_009389 [Vitis vinifera] 65 3e-08 XP_015575617.1 PREDICTED: Niemann-Pick C1 protein isoform X2 [Ri... 65 3e-08 EEF52867.1 hedgehog receptor, putative [Ricinus communis] 65 3e-08 >XP_010538733.1 PREDICTED: Niemann-Pick C1 protein-like [Tarenaya hassleriana] Length = 203 Score = 64.3 bits (155), Expect = 7e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 ++IFPYSVFY FFEQYLDIWKTALINL+IA+G F L C Sbjct: 8 MEIFPYSVFYMFFEQYLDIWKTALINLSIAIGAVFVVCLVITC 50 >XP_010242906.1 PREDICTED: Niemann-Pick C1 protein-like [Nelumbo nucifera] Length = 699 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 I+IFPYSVFY FFEQYLDIW+TALINLAIA+G F L C Sbjct: 504 IEIFPYSVFYMFFEQYLDIWRTALINLAIALGAVFIVCLVITC 546 >XP_019054366.1 PREDICTED: Niemann-Pick C1 protein-like isoform X2 [Nelumbo nucifera] Length = 1294 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 I+IFPYSVFY FFEQYLDIW+TALINLAIA+G F L C Sbjct: 1097 IEIFPYSVFYMFFEQYLDIWRTALINLAIALGAVFIVCLVITC 1139 >XP_019054365.1 PREDICTED: Niemann-Pick C1 protein-like isoform X1 [Nelumbo nucifera] Length = 1295 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 I+IFPYSVFY FFEQYLDIW+TALINLAIA+G F L C Sbjct: 1098 IEIFPYSVFYMFFEQYLDIWRTALINLAIALGAVFIVCLVITC 1140 >KGN46670.1 hypothetical protein Csa_6G120400 [Cucumis sativus] Length = 195 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG 686 +DIFPYSVFY FFEQYLDIWKTAL+N+AIA+G Sbjct: 1 MDIFPYSVFYIFFEQYLDIWKTALMNIAIALG 32 >XP_018836419.1 PREDICTED: Niemann-Pick C1 protein-like isoform X2 [Juglans regia] Length = 1175 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 I+IFPYSVFY FFEQYLDIW+TALINLAIA+G F L C Sbjct: 1107 IEIFPYSVFYMFFEQYLDIWRTALINLAIAIGAVFIVCLVITC 1149 >OMO50471.1 Patched [Corchorus capsularis] Length = 1272 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 ++IFPYSVFY FFEQYLDIWKTALINLAIA+G F L C Sbjct: 1077 MEIFPYSVFYMFFEQYLDIWKTALINLAIAIGAVFIVCLVITC 1119 >XP_016707676.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypium hirsutum] Length = 1287 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 ++IFPYSVFY FFEQYLDIWKTALINLAIA+G F L C Sbjct: 1092 MEIFPYSVFYMFFEQYLDIWKTALINLAIAIGAVFIVCLVITC 1134 >XP_016702902.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypium hirsutum] Length = 1287 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 ++IFPYSVFY FFEQYLDIWKTALINLAIA+G F L C Sbjct: 1092 MEIFPYSVFYMFFEQYLDIWKTALINLAIAIGAVFIVCLVITC 1134 >XP_012464596.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypium raimondii] KJB14243.1 hypothetical protein B456_002G115700 [Gossypium raimondii] Length = 1287 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 ++IFPYSVFY FFEQYLDIWKTALINLAIA+G F L C Sbjct: 1092 MEIFPYSVFYMFFEQYLDIWKTALINLAIAIGAVFIVCLVITC 1134 >XP_017642001.1 PREDICTED: Niemann-Pick C1 protein-like [Gossypium arboreum] KHG02724.1 Niemann-Pick C1 [Gossypium arboreum] Length = 1287 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 ++IFPYSVFY FFEQYLDIWKTALINLAIA+G F L C Sbjct: 1092 MEIFPYSVFYMFFEQYLDIWKTALINLAIAIGAVFIVCLVITC 1134 >XP_018836418.1 PREDICTED: Niemann-Pick C1 protein-like isoform X1 [Juglans regia] Length = 1302 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 I+IFPYSVFY FFEQYLDIW+TALINLAIA+G F L C Sbjct: 1107 IEIFPYSVFYMFFEQYLDIWRTALINLAIAIGAVFIVCLVITC 1149 >XP_011627546.1 PREDICTED: Niemann-Pick C1 protein [Amborella trichopoda] XP_011627547.1 PREDICTED: Niemann-Pick C1 protein [Amborella trichopoda] Length = 1275 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 I+IFPYSVFY FFEQYLDIW+TALINLA+A+G F L C Sbjct: 1081 IEIFPYSVFYIFFEQYLDIWRTALINLALALGAVFLVCLVITC 1123 >OAY22513.1 hypothetical protein MANES_18G004200 [Manihot esculenta] Length = 1289 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 +++FPYSVFY FFEQYLDIWKTALINLAIA+G F L C Sbjct: 1094 MEVFPYSVFYMFFEQYLDIWKTALINLAIAIGAVFVVCLVITC 1136 >OAY50377.1 hypothetical protein MANES_05G130900 [Manihot esculenta] Length = 1296 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 +++FPYSVFY FFEQYLDIWKTALINLAIA+G F L C Sbjct: 1101 MEVFPYSVFYMFFEQYLDIWKTALINLAIAIGAVFVVCLAITC 1143 >ERN17219.1 hypothetical protein AMTR_s00044p00170650 [Amborella trichopoda] Length = 1297 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 I+IFPYSVFY FFEQYLDIW+TALINLA+A+G F L C Sbjct: 1103 IEIFPYSVFYIFFEQYLDIWRTALINLALALGAVFLVCLVITC 1145 >XP_010094557.1 Niemann-Pick C1 protein [Morus notabilis] EXB56311.1 Niemann-Pick C1 protein [Morus notabilis] Length = 1455 Score = 65.1 bits (157), Expect = 3e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 I+IFPYSVFY FFEQYLDIWKTALINL+IA+G F L C Sbjct: 1047 IEIFPYSVFYMFFEQYLDIWKTALINLSIAIGAVFIVCLIITC 1089 >CAN75892.1 hypothetical protein VITISV_009389 [Vitis vinifera] Length = 1050 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 I IFPYSVFY FFEQYLDIW+TALINLAIA+G F L C Sbjct: 882 IQIFPYSVFYMFFEQYLDIWRTALINLAIAIGAVFIVCLVITC 924 >XP_015575617.1 PREDICTED: Niemann-Pick C1 protein isoform X2 [Ricinus communis] Length = 1103 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 ++IFPYSVFY FFEQYLDIW+TALINLAIA+G F L C Sbjct: 908 LEIFPYSVFYMFFEQYLDIWRTALINLAIAIGAVFLVCLVITC 950 >EEF52867.1 hedgehog receptor, putative [Ricinus communis] Length = 1235 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 781 IDIFPYSVFYTFFEQYLDIWKTALINLAIAMG**FYYLLTAKC 653 ++IFPYSVFY FFEQYLDIW+TALINLAIA+G F L C Sbjct: 1040 LEIFPYSVFYMFFEQYLDIWRTALINLAIAIGAVFLVCLVITC 1082