BLASTX nr result
ID: Panax25_contig00008321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00008321 (823 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU42218.1 hypothetical protein TSUD_351280 [Trifolium subterran... 59 2e-06 XP_004510341.1 PREDICTED: uncharacterized protein At1g51745 [Cic... 59 2e-06 XP_013444253.1 tudor/PWWP/MBT superfamily protein [Medicago trun... 58 6e-06 >GAU42218.1 hypothetical protein TSUD_351280 [Trifolium subterraneum] Length = 774 Score = 59.3 bits (142), Expect = 2e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 749 MGISGEAKIMGINESLGGLIWVHRWNGSWWPGQILA 642 MG SGE+ I GIN S+GGL+WV R NGSWWPG+I++ Sbjct: 1 MGSSGESNINGINASVGGLVWVRRRNGSWWPGRIMS 36 >XP_004510341.1 PREDICTED: uncharacterized protein At1g51745 [Cicer arietinum] Length = 789 Score = 59.3 bits (142), Expect = 2e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 749 MGISGEAKIMGINESLGGLIWVHRWNGSWWPGQILA 642 MG SGE+ I GIN S+GGL+WV R NGSWWPG+I++ Sbjct: 1 MGSSGESNINGINASVGGLVWVRRRNGSWWPGRIMS 36 >XP_013444253.1 tudor/PWWP/MBT superfamily protein [Medicago truncatula] KEH18280.1 tudor/PWWP/MBT superfamily protein [Medicago truncatula] Length = 782 Score = 58.2 bits (139), Expect = 6e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 752 EMGISGEAKIMGINESLGGLIWVHRWNGSWWPGQILA 642 EMG S E+ I GIN S+GGL+WV R NGSWWPG+I++ Sbjct: 6 EMGSSEESNINGINASVGGLVWVRRRNGSWWPGRIMS 42