BLASTX nr result
ID: Panax25_contig00008200
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00008200 (525 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017219062.1 PREDICTED: F-box protein At4g00755-like [Daucus c... 60 2e-07 >XP_017219062.1 PREDICTED: F-box protein At4g00755-like [Daucus carota subsp. sativus] KZM88091.1 hypothetical protein DCAR_025166 [Daucus carota subsp. sativus] Length = 365 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/74 (43%), Positives = 39/74 (52%) Frame = +3 Query: 3 VSHVQVMRRPLFPAFGVNSFEPSGKFTFNYSAEAFPGILQNDXXXXXXXXXXXXEERVWG 182 VSHV+V+ RPLFPAF V+ E SGKF Y EA + ++ W Sbjct: 278 VSHVEVIGRPLFPAFDVDITESSGKFILKYYPEALLRTMSTVSNPVHTDVDTREDDGAWE 337 Query: 183 HFEGLVEFLMQRNE 224 H + LV FLMQRNE Sbjct: 338 HLQELVGFLMQRNE 351