BLASTX nr result
ID: Panax25_contig00007677
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00007677 (577 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017220760.1 PREDICTED: uncharacterized protein LOC108197609 [... 65 1e-09 XP_017232514.1 PREDICTED: uncharacterized protein LOC108206654 [... 63 7e-09 >XP_017220760.1 PREDICTED: uncharacterized protein LOC108197609 [Daucus carota subsp. sativus] KZM84958.1 hypothetical protein DCAR_027620 [Daucus carota subsp. sativus] Length = 215 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +1 Query: 460 SAILGKLKNFLPVMSEANKRLQLAAMDNSKDFDIEALED 576 S +LGKLK+FLPVMS+ANK+LQLAAMDN+K FDIE+LED Sbjct: 54 SQVLGKLKDFLPVMSDANKKLQLAAMDNAKVFDIESLED 92 >XP_017232514.1 PREDICTED: uncharacterized protein LOC108206654 [Daucus carota subsp. sativus] KZN06898.1 hypothetical protein DCAR_007735 [Daucus carota subsp. sativus] Length = 215 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = +1 Query: 460 SAILGKLKNFLPVMSEANKRLQLAAMDNSKDFDIEALED 576 S +L KLK+FLPVMSEANK+LQLAAMDN+K FDIE++ED Sbjct: 57 SQVLDKLKDFLPVMSEANKKLQLAAMDNTKVFDIESIED 95