BLASTX nr result
ID: Panax25_contig00007311
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00007311 (858 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018845203.1 PREDICTED: sphinganine C4-monooxygenase 1-like [J... 108 2e-24 BAD43737.1 putative sterol desaturase, partial [Arabidopsis thal... 101 6e-24 XP_017219974.1 PREDICTED: sphinganine C4-monooxygenase 1-like [D... 105 2e-23 XP_010089755.1 Sphingoid base hydroxylase 2 [Morus notabilis] EX... 105 2e-23 GAU42565.1 hypothetical protein TSUD_240410 [Trifolium subterran... 105 2e-23 XP_012855270.1 PREDICTED: sphinganine C(4)-monooxygenase 1 [Eryt... 105 2e-23 XP_011071002.1 PREDICTED: sphinganine C(4)-monooxygenase 1-like ... 105 2e-23 XP_010044737.1 PREDICTED: sphinganine C4-monooxygenase 1 [Eucaly... 104 4e-23 XP_004490042.1 PREDICTED: sphinganine C(4)-monooxygenase 1 [Cice... 104 4e-23 XP_016691112.1 PREDICTED: sphinganine C4-monooxygenase 1-like [G... 104 6e-23 XP_016743043.1 PREDICTED: sphinganine C4-monooxygenase 1-like [G... 104 6e-23 XP_017622764.1 PREDICTED: sphinganine C4-monooxygenase 1-like [G... 104 6e-23 XP_007046113.1 PREDICTED: sphinganine C4-monooxygenase 1 [Theobr... 104 6e-23 XP_002275229.1 PREDICTED: sphinganine C4-monooxygenase 1 [Vitis ... 104 6e-23 XP_010089753.1 Sphingoid base hydroxylase 2 [Morus notabilis] EX... 103 8e-23 JAU61244.1 Sphinganine C(4)-monooxygenase 1, partial [Noccaea ca... 101 8e-23 XP_015576859.1 PREDICTED: sphinganine C4-monooxygenase 1 isoform... 102 9e-23 OAY50001.1 hypothetical protein MANES_05G100600 [Manihot esculenta] 103 9e-23 OAY61409.1 hypothetical protein MANES_01G186400 [Manihot esculenta] 103 1e-22 XP_016705257.1 PREDICTED: sphinganine C4-monooxygenase 1 [Gossyp... 103 2e-22 >XP_018845203.1 PREDICTED: sphinganine C4-monooxygenase 1-like [Juglans regia] Length = 257 Score = 108 bits (269), Expect = 2e-24 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYGNKYNFSQPFF++WDRILGTYMPYSL+KRA+GG EARP DYK+ Sbjct: 204 YHDVHHQLYGNKYNFSQPFFIMWDRILGTYMPYSLEKRAAGGFEARPTRDYKD 256 >BAD43737.1 putative sterol desaturase, partial [Arabidopsis thaliana] Length = 64 Score = 101 bits (251), Expect = 6e-24 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHDIHHQLYG KYNFSQPFFV+WDRILGTYMPYSL+KR GG EARP ++K+ Sbjct: 11 YHDIHHQLYGTKYNFSQPFFVMWDRILGTYMPYSLEKREDGGFEARPTKEFKD 63 >XP_017219974.1 PREDICTED: sphinganine C4-monooxygenase 1-like [Daucus carota subsp. sativus] KZM85170.1 hypothetical protein DCAR_027408 [Daucus carota subsp. sativus] Length = 258 Score = 105 bits (262), Expect = 2e-23 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKES 162 YHDIHHQ YG KYNFSQPFFV+WDR+LGT+MPY+LQKRA GGLEARPA +YKES Sbjct: 205 YHDIHHQRYGTKYNFSQPFFVVWDRVLGTHMPYALQKRAEGGLEARPAKEYKES 258 >XP_010089755.1 Sphingoid base hydroxylase 2 [Morus notabilis] EXB38331.1 Sphingoid base hydroxylase 2 [Morus notabilis] Length = 258 Score = 105 bits (262), Expect = 2e-23 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKES 162 YHD+HHQLYG+KYNFSQPFFV+WDRILGTYMPYSL KRA GG EARP DYK++ Sbjct: 205 YHDVHHQLYGSKYNFSQPFFVMWDRILGTYMPYSLDKRAGGGFEARPLKDYKDA 258 >GAU42565.1 hypothetical protein TSUD_240410 [Trifolium subterraneum] Length = 260 Score = 105 bits (262), Expect = 2e-23 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYGNKYNFSQPFFV+WD+ILGTYMPYSL+KR SGG E+RP DYK+ Sbjct: 207 YHDVHHQLYGNKYNFSQPFFVMWDKILGTYMPYSLEKRPSGGFESRPCKDYKD 259 >XP_012855270.1 PREDICTED: sphinganine C(4)-monooxygenase 1 [Erythranthe guttata] EYU22423.1 hypothetical protein MIMGU_mgv1a012069mg [Erythranthe guttata] Length = 262 Score = 105 bits (262), Expect = 2e-23 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKES 162 YHDIHHQLYGNKYNFSQPFFV+WDRILGTYMPYSL+KR+ GG EARP D KE+ Sbjct: 209 YHDIHHQLYGNKYNFSQPFFVMWDRILGTYMPYSLEKRSKGGFEARPGKDCKEN 262 >XP_011071002.1 PREDICTED: sphinganine C(4)-monooxygenase 1-like [Sesamum indicum] Length = 263 Score = 105 bits (262), Expect = 2e-23 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKES 162 YHDIHHQLYGNKYNFSQPFFV+WDRILGTYMPYSL+KR +GG EARP D KE+ Sbjct: 210 YHDIHHQLYGNKYNFSQPFFVMWDRILGTYMPYSLEKRTNGGFEARPTKDCKEN 263 >XP_010044737.1 PREDICTED: sphinganine C4-monooxygenase 1 [Eucalyptus grandis] KCW86839.1 hypothetical protein EUGRSUZ_B03436 [Eucalyptus grandis] Length = 258 Score = 104 bits (260), Expect = 4e-23 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYGNKYNFSQPFFV+WDRILGTYMPY+L+KR GG EARP +YKE Sbjct: 205 YHDVHHQLYGNKYNFSQPFFVMWDRILGTYMPYTLEKRKGGGFEARPTREYKE 257 >XP_004490042.1 PREDICTED: sphinganine C(4)-monooxygenase 1 [Cicer arietinum] Length = 259 Score = 104 bits (260), Expect = 4e-23 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYGNKYNFSQPFFV+WD++LGTYMPYSL+KR+SGG E RP DYK+ Sbjct: 206 YHDVHHQLYGNKYNFSQPFFVMWDKMLGTYMPYSLEKRSSGGFETRPCKDYKD 258 >XP_016691112.1 PREDICTED: sphinganine C4-monooxygenase 1-like [Gossypium hirsutum] Length = 258 Score = 104 bits (259), Expect = 6e-23 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYG+KYNFSQPFFV+WDRILGTYMPYSL+KRA GG EARP ++KE Sbjct: 205 YHDVHHQLYGSKYNFSQPFFVMWDRILGTYMPYSLEKRAEGGFEARPTKEFKE 257 >XP_016743043.1 PREDICTED: sphinganine C4-monooxygenase 1-like [Gossypium hirsutum] Length = 258 Score = 104 bits (259), Expect = 6e-23 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYG+KYNFSQPFFV+WDRILGTYMPYSL+KRA GG EARP ++KE Sbjct: 205 YHDVHHQLYGSKYNFSQPFFVMWDRILGTYMPYSLEKRAEGGFEARPTKEFKE 257 >XP_017622764.1 PREDICTED: sphinganine C4-monooxygenase 1-like [Gossypium arboreum] KHG19546.1 Sphingoid base hydroxylase 1 -like protein [Gossypium arboreum] Length = 258 Score = 104 bits (259), Expect = 6e-23 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYG+KYNFSQPFFV+WDRILGTYMPYSL+KRA GG EARP ++KE Sbjct: 205 YHDVHHQLYGSKYNFSQPFFVMWDRILGTYMPYSLEKRAEGGFEARPTKEFKE 257 >XP_007046113.1 PREDICTED: sphinganine C4-monooxygenase 1 [Theobroma cacao] EOY01945.1 Sphingoid base hydroxylase 2 [Theobroma cacao] Length = 258 Score = 104 bits (259), Expect = 6e-23 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYG+KYNFSQPFF++WDRILGTYMPYSL+KRA GG EARP +YK+ Sbjct: 205 YHDVHHQLYGSKYNFSQPFFIMWDRILGTYMPYSLEKRADGGFEARPTKEYKD 257 >XP_002275229.1 PREDICTED: sphinganine C4-monooxygenase 1 [Vitis vinifera] CBI31968.3 unnamed protein product, partial [Vitis vinifera] Length = 258 Score = 104 bits (259), Expect = 6e-23 Identities = 43/54 (79%), Positives = 51/54 (94%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKES 162 YHDIHHQLYG+KYNFSQPFFV+WD+ILGTYMPYSL+KRA GGLEARP ++K++ Sbjct: 205 YHDIHHQLYGSKYNFSQPFFVMWDKILGTYMPYSLEKRAGGGLEARPTKEFKDN 258 >XP_010089753.1 Sphingoid base hydroxylase 2 [Morus notabilis] EXB38329.1 Sphingoid base hydroxylase 2 [Morus notabilis] Length = 258 Score = 103 bits (258), Expect = 8e-23 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKES 162 YHD+HHQLYG+KYNFSQPFFV+WDRILGTYMPYSL KRA GG E RP DYK++ Sbjct: 205 YHDVHHQLYGSKYNFSQPFFVMWDRILGTYMPYSLDKRAGGGFETRPLKDYKDA 258 >JAU61244.1 Sphinganine C(4)-monooxygenase 1, partial [Noccaea caerulescens] Length = 172 Score = 101 bits (252), Expect = 8e-23 Identities = 41/53 (77%), Positives = 50/53 (94%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYG+K+NFSQPFFV+WDRILGTYMPY+L+KRA GGLEARP ++K+ Sbjct: 119 YHDVHHQLYGSKFNFSQPFFVVWDRILGTYMPYTLEKRADGGLEARPTKEFKD 171 >XP_015576859.1 PREDICTED: sphinganine C4-monooxygenase 1 isoform X2 [Ricinus communis] Length = 217 Score = 102 bits (255), Expect = 9e-23 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYG+KYNFSQPFFV+WD+ILGTYMPYSL+KR GG EARPA +YK+ Sbjct: 164 YHDVHHQLYGSKYNFSQPFFVMWDKILGTYMPYSLEKRDGGGFEARPAKEYKD 216 >OAY50001.1 hypothetical protein MANES_05G100600 [Manihot esculenta] Length = 264 Score = 103 bits (258), Expect = 9e-23 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHDIHHQLYG+KYNFSQPFFV+WDRILGTYMPY+L+KR GG EARPA +YK+ Sbjct: 211 YHDIHHQLYGSKYNFSQPFFVMWDRILGTYMPYTLEKRVEGGFEARPAKEYKD 263 >OAY61409.1 hypothetical protein MANES_01G186400 [Manihot esculenta] Length = 263 Score = 103 bits (257), Expect = 1e-22 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHD+HHQLYG+KYNFSQPFFV+WDR+LGTYMPYSL+KR GG EARPA +YK+ Sbjct: 210 YHDVHHQLYGSKYNFSQPFFVMWDRLLGTYMPYSLEKREGGGFEARPAKEYKD 262 >XP_016705257.1 PREDICTED: sphinganine C4-monooxygenase 1 [Gossypium hirsutum] XP_017637734.1 PREDICTED: sphinganine C4-monooxygenase 1 [Gossypium arboreum] KHG16240.1 Sphingoid base hydroxylase 1 -like protein [Gossypium arboreum] Length = 258 Score = 103 bits (256), Expect = 2e-22 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = +1 Query: 1 YHDIHHQLYGNKYNFSQPFFVLWDRILGTYMPYSLQKRASGGLEARPATDYKE 159 YHDIHHQLYG KYNFSQPFFV+WDRILGTYMPYSL+KRA GG EARP ++K+ Sbjct: 205 YHDIHHQLYGTKYNFSQPFFVMWDRILGTYMPYSLEKRAEGGFEARPTKEFKD 257