BLASTX nr result
ID: Panax25_contig00007260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00007260 (498 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002515206.1 PREDICTED: chlorophyll a-b binding protein of LHC... 61 6e-14 AAB87573.1 chlorophyll a/b binding protein of LHCII type I precu... 60 1e-13 XP_008358195.1 PREDICTED: chlorophyll a-b binding protein of LHC... 60 1e-13 XP_008343203.2 PREDICTED: chlorophyll a-b binding protein of LHC... 59 2e-13 AFO67221.1 putative chlorophyll a/b binding protein, partial [Ar... 58 4e-13 OMO82201.1 Chlorophyll A-B binding protein, plant [Corchorus oli... 58 7e-13 XP_011096521.1 PREDICTED: chlorophyll a-b binding protein 21, ch... 57 1e-12 KCW75953.1 hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis] 57 1e-12 OMO64079.1 Chlorophyll A-B binding protein, plant [Corchorus cap... 56 2e-12 XP_008447450.1 PREDICTED: chlorophyll a-b binding protein of LHC... 56 2e-12 XP_007221496.1 hypothetical protein PRUPE_ppa010066mg [Prunus pe... 55 2e-12 XP_009628755.1 PREDICTED: chlorophyll a-b binding protein 40, ch... 53 7e-12 XP_004148579.1 PREDICTED: chlorophyll a-b binding protein of LHC... 54 7e-12 ACA52202.1 chloroplast chlorophyll A/B-binding protein, partial ... 54 8e-12 ACA52201.1 chloroplast chlorophyll A/B-binding protein, partial ... 54 8e-12 XP_016448715.1 PREDICTED: chlorophyll a-b binding protein 40, ch... 52 9e-12 XP_009795316.1 PREDICTED: chlorophyll a-b binding protein 40, ch... 52 9e-12 XP_009795315.1 PREDICTED: chlorophyll a-b binding protein 40, ch... 52 9e-12 XP_009782924.1 PREDICTED: chlorophyll a-b binding protein 50, ch... 52 9e-12 XP_009618329.1 PREDICTED: chlorophyll a-b binding protein 40, ch... 52 9e-12 >XP_002515206.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Ricinus communis] EEF47190.1 chlorophyll A/B binding protein, putative [Ricinus communis] Length = 267 Score = 61.2 bits (147), Expect(2) = 6e-14 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 4/52 (7%) Frame = +3 Query: 324 LPATV----GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFSVVPQRRIPG 467 LPATV G ++MRKT+ PA SSGSPWYGP DR+KYLGPFS P + G Sbjct: 23 LPATVRSSNGRVTMRKTAGKPAASSGSPWYGP-DRVKYLGPFSGEPPSYLTG 73 Score = 43.1 bits (100), Expect(2) = 6e-14 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 439 PSYLNGEFPGD*GWDTAGLS 498 PSYL GEFPGD GWDTAGLS Sbjct: 68 PSYLTGEFPGDYGWDTAGLS 87 >AAB87573.1 chlorophyll a/b binding protein of LHCII type I precursor [Panax ginseng] Length = 266 Score = 59.7 bits (143), Expect(2) = 1e-13 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 339 GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFS 440 G ISMRKT K PA SSGSPWYGP DR+KYLGPFS Sbjct: 31 GRISMRKTGKKPAASSGSPWYGP-DRVKYLGPFS 63 Score = 43.5 bits (101), Expect(2) = 1e-13 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 +PSYL GEFPGD GWDTAGLS Sbjct: 66 APSYLTGEFPGDYGWDTAGLS 86 >XP_008358195.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Malus domestica] Length = 265 Score = 59.7 bits (143), Expect(2) = 1e-13 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 339 GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFS 440 G +SMRKT+K PA SSGSPWYGP DR+KYLGPFS Sbjct: 30 GRVSMRKTAKKPAVSSGSPWYGP-DRVKYLGPFS 62 Score = 43.5 bits (101), Expect(2) = 1e-13 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 +PSYL GEFPGD GWDTAGLS Sbjct: 65 APSYLTGEFPGDYGWDTAGLS 85 >XP_008343203.2 PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus domestica] XP_008362557.2 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Malus domestica] XP_018504406.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Pyrus x bretschneideri] XP_018505288.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Pyrus x bretschneideri] XP_018507333.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Pyrus x bretschneideri] Length = 265 Score = 59.3 bits (142), Expect(2) = 2e-13 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 339 GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFS 440 G +SMRKT K PA SSGSPWYGP DR+KYLGPFS Sbjct: 30 GRVSMRKTGKKPAVSSGSPWYGP-DRVKYLGPFS 62 Score = 43.5 bits (101), Expect(2) = 2e-13 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 +PSYL GEFPGD GWDTAGLS Sbjct: 65 APSYLTGEFPGDYGWDTAGLS 85 >AFO67221.1 putative chlorophyll a/b binding protein, partial [Aralia elata] Length = 152 Score = 58.2 bits (139), Expect(2) = 4e-13 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +3 Query: 339 GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFS 440 G ISMRKT K P SSGSPWYGP DR+KYLGPFS Sbjct: 31 GRISMRKTGKKPVASSGSPWYGP-DRVKYLGPFS 63 Score = 43.5 bits (101), Expect(2) = 4e-13 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 +PSYL GEFPGD GWDTAGLS Sbjct: 66 APSYLTGEFPGDYGWDTAGLS 86 >OMO82201.1 Chlorophyll A-B binding protein, plant [Corchorus olitorius] Length = 244 Score = 57.8 bits (138), Expect(2) = 7e-13 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = +3 Query: 339 GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFSVVPQRRIPG 467 G +SMRKT PA SSGSPWYGP DR+KYLGPFS P + G Sbjct: 29 GRVSMRKTVGKPAASSGSPWYGP-DRVKYLGPFSGEPPSYLTG 70 Score = 43.1 bits (100), Expect(2) = 7e-13 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 439 PSYLNGEFPGD*GWDTAGLS 498 PSYL GEFPGD GWDTAGLS Sbjct: 65 PSYLTGEFPGDYGWDTAGLS 84 >XP_011096521.1 PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like [Sesamum indicum] Length = 286 Score = 57.0 bits (136), Expect(2) = 1e-12 Identities = 37/86 (43%), Positives = 48/86 (55%), Gaps = 3/86 (3%) Frame = +3 Query: 219 RSPTPLHQTTLAPTHLLTICRQRFLQAQSPMFLPWLPATVGS--ISMRKT-SKAPATSSG 389 +S P H TT+A + + + F Q+ P P G+ +SMRKT +K SSG Sbjct: 10 KSSLPFHSTTMAAS-TMALSSPSFA-GQAVKLSPSAPEITGNGRVSMRKTVAKPKPASSG 67 Query: 390 SPWYGPDDRMKYLGPFSVVPQRRIPG 467 SPWYGPD R+KYLGPFS P + G Sbjct: 68 SPWYGPD-RVKYLGPFSGEPPSYLTG 92 Score = 43.1 bits (100), Expect(2) = 1e-12 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 439 PSYLNGEFPGD*GWDTAGLS 498 PSYL GEFPGD GWDTAGLS Sbjct: 87 PSYLTGEFPGDYGWDTAGLS 106 >KCW75953.1 hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis] Length = 300 Score = 56.6 bits (135), Expect(2) = 1e-12 Identities = 38/85 (44%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = +3 Query: 219 RSPTPLHQTTLAPTHLLTICRQRFLQAQSPMFLPWLPATVGS--ISMRKTSKAPATSSGS 392 RS + +H T A T L+ L Q+ P P +G+ ISMRK + P SSGS Sbjct: 27 RSSSQIHSTMAASTMALS---SPSLAGQAVKLSPSTPELLGNGRISMRKAVRKPV-SSGS 82 Query: 393 PWYGPDDRMKYLGPFSVVPQRRIPG 467 PWYGP DR KYLGPFS P + G Sbjct: 83 PWYGP-DRAKYLGPFSGEPPSYLTG 106 Score = 43.1 bits (100), Expect(2) = 1e-12 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 439 PSYLNGEFPGD*GWDTAGLS 498 PSYL GEFPGD GWDTAGLS Sbjct: 101 PSYLTGEFPGDYGWDTAGLS 120 >OMO64079.1 Chlorophyll A-B binding protein, plant [Corchorus capsularis] Length = 264 Score = 56.2 bits (134), Expect(2) = 2e-12 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = +3 Query: 339 GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFSVVPQRRIPG 467 G +SMRKT P SSGSPWYGP DR+KYLGPFS P + G Sbjct: 29 GRVSMRKTVGKPVASSGSPWYGP-DRVKYLGPFSGEPPSYLTG 70 Score = 43.1 bits (100), Expect(2) = 2e-12 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 439 PSYLNGEFPGD*GWDTAGLS 498 PSYL GEFPGD GWDTAGLS Sbjct: 65 PSYLTGEFPGDYGWDTAGLS 84 >XP_008447450.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Cucumis melo] Length = 265 Score = 55.8 bits (133), Expect(2) = 2e-12 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +3 Query: 339 GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFSVVPQRRIPG 467 G ISMRK+ K PA SSGSPWYGP DR+KYLGPFS P + G Sbjct: 31 GRISMRKSGK-PAASSGSPWYGP-DRVKYLGPFSGEPPSYLKG 71 Score = 43.1 bits (100), Expect(2) = 2e-12 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 439 PSYLNGEFPGD*GWDTAGLS 498 PSYL GEFPGD GWDTAGLS Sbjct: 66 PSYLKGEFPGDYGWDTAGLS 85 >XP_007221496.1 hypothetical protein PRUPE_ppa010066mg [Prunus persica] XP_008227797.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Prunus mume] ONI14720.1 hypothetical protein PRUPE_3G004100 [Prunus persica] Length = 265 Score = 55.5 bits (132), Expect(2) = 2e-12 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 339 GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFS 440 G +SMR+ ++ PA SSGSPWYGP DR+KYLGPFS Sbjct: 30 GRVSMRRAARKPAVSSGSPWYGP-DRVKYLGPFS 62 Score = 43.5 bits (101), Expect(2) = 2e-12 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 +PSYL GEFPGD GWDTAGLS Sbjct: 65 APSYLTGEFPGDYGWDTAGLS 85 >XP_009628755.1 PREDICTED: chlorophyll a-b binding protein 40, chloroplastic [Nicotiana tomentosiformis] XP_016447636.1 PREDICTED: chlorophyll a-b binding protein 40, chloroplastic [Nicotiana tabacum] XP_016448162.1 PREDICTED: chlorophyll a-b binding protein 40, chloroplastic [Nicotiana tabacum] P27495.1 RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor CAA36958.1 unnamed protein product [Nicotiana tabacum] Length = 267 Score = 52.8 bits (125), Expect(2) = 7e-12 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +3 Query: 339 GSISMRKT-SKAPATSSGSPWYGPDDRMKYLGPFS 440 G ++MRKT SKA SSGSPWYGPD R+KYLGPFS Sbjct: 31 GKVTMRKTASKAKTVSSGSPWYGPD-RVKYLGPFS 64 Score = 44.7 bits (104), Expect(2) = 7e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 SPSYL GEFPGD GWDTAGLS Sbjct: 67 SPSYLTGEFPGDYGWDTAGLS 87 >XP_004148579.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Cucumis sativus] KGN58532.1 hypothetical protein Csa_3G664560 [Cucumis sativus] Length = 265 Score = 54.3 bits (129), Expect(2) = 7e-12 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 339 GSISMRKTSKAPATSSGSPWYGPDDRMKYLGPFSVVPQRRIPG 467 G ++MRK+ K PA SSGSPWYGP DR+KYLGPFS P + G Sbjct: 31 GRVTMRKSGK-PAASSGSPWYGP-DRVKYLGPFSGEPPSYLKG 71 Score = 43.1 bits (100), Expect(2) = 7e-12 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 439 PSYLNGEFPGD*GWDTAGLS 498 PSYL GEFPGD GWDTAGLS Sbjct: 66 PSYLKGEFPGDYGWDTAGLS 85 >ACA52202.1 chloroplast chlorophyll A/B-binding protein, partial [Oenothera grandiflora] Length = 118 Score = 53.9 bits (128), Expect(2) = 8e-12 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 2/38 (5%) Frame = +3 Query: 333 TVGSISMRKTS--KAPATSSGSPWYGPDDRMKYLGPFS 440 T G I+MRKT+ PA SSGSPWYGP DR+KYLGPFS Sbjct: 15 TTGGITMRKTAGKAKPAVSSGSPWYGP-DRVKYLGPFS 51 Score = 43.5 bits (101), Expect(2) = 8e-12 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 +PSYL GEFPGD GWDTAGLS Sbjct: 54 APSYLTGEFPGDYGWDTAGLS 74 >ACA52201.1 chloroplast chlorophyll A/B-binding protein, partial [Oenothera elata subsp. hookeri] Length = 119 Score = 53.9 bits (128), Expect(2) = 8e-12 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 2/38 (5%) Frame = +3 Query: 333 TVGSISMRKTS--KAPATSSGSPWYGPDDRMKYLGPFS 440 T G I+MRKT+ PA SSGSPWYGP DR+KYLGPFS Sbjct: 28 TTGGITMRKTAGKAKPAVSSGSPWYGP-DRVKYLGPFS 64 Score = 43.5 bits (101), Expect(2) = 8e-12 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 +PSYL GEFPGD GWDTAGLS Sbjct: 67 APSYLTGEFPGDYGWDTAGLS 87 >XP_016448715.1 PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Nicotiana tabacum] Length = 267 Score = 52.4 bits (124), Expect(2) = 9e-12 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +3 Query: 339 GSISMRKT-SKAPATSSGSPWYGPDDRMKYLGPFS 440 G ++MRKT SKA SSGSPWYGP DR+KYLGPFS Sbjct: 31 GKVTMRKTASKAKPVSSGSPWYGP-DRVKYLGPFS 64 Score = 44.7 bits (104), Expect(2) = 9e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 SPSYL GEFPGD GWDTAGLS Sbjct: 67 SPSYLTGEFPGDYGWDTAGLS 87 >XP_009795316.1 PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Nicotiana sylvestris] BAA25392.1 light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 267 Score = 52.4 bits (124), Expect(2) = 9e-12 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +3 Query: 339 GSISMRKT-SKAPATSSGSPWYGPDDRMKYLGPFS 440 G ++MRKT SKA SSGSPWYGP DR+KYLGPFS Sbjct: 31 GKVTMRKTASKAKPVSSGSPWYGP-DRVKYLGPFS 64 Score = 44.7 bits (104), Expect(2) = 9e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 SPSYL GEFPGD GWDTAGLS Sbjct: 67 SPSYLTGEFPGDYGWDTAGLS 87 >XP_009795315.1 PREDICTED: chlorophyll a-b binding protein 40, chloroplastic [Nicotiana sylvestris] Length = 267 Score = 52.4 bits (124), Expect(2) = 9e-12 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +3 Query: 339 GSISMRKT-SKAPATSSGSPWYGPDDRMKYLGPFS 440 G ++MRKT SKA SSGSPWYGP DR+KYLGPFS Sbjct: 31 GKVTMRKTASKAKPVSSGSPWYGP-DRVKYLGPFS 64 Score = 44.7 bits (104), Expect(2) = 9e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 SPSYL GEFPGD GWDTAGLS Sbjct: 67 SPSYLTGEFPGDYGWDTAGLS 87 >XP_009782924.1 PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like [Nicotiana sylvestris] Length = 267 Score = 52.4 bits (124), Expect(2) = 9e-12 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +3 Query: 339 GSISMRKT-SKAPATSSGSPWYGPDDRMKYLGPFS 440 G ++MRKT SKA SSGSPWYGP DR+KYLGPFS Sbjct: 31 GKVTMRKTASKAKPVSSGSPWYGP-DRVKYLGPFS 64 Score = 44.7 bits (104), Expect(2) = 9e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 SPSYL GEFPGD GWDTAGLS Sbjct: 67 SPSYLTGEFPGDYGWDTAGLS 87 >XP_009618329.1 PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Nicotiana tomentosiformis] XP_009628756.1 PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Nicotiana tomentosiformis] Length = 267 Score = 52.4 bits (124), Expect(2) = 9e-12 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +3 Query: 339 GSISMRKT-SKAPATSSGSPWYGPDDRMKYLGPFS 440 G ++MRKT SKA SSGSPWYGP DR+KYLGPFS Sbjct: 31 GKVTMRKTASKAKPVSSGSPWYGP-DRVKYLGPFS 64 Score = 44.7 bits (104), Expect(2) = 9e-12 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +1 Query: 436 SPSYLNGEFPGD*GWDTAGLS 498 SPSYL GEFPGD GWDTAGLS Sbjct: 67 SPSYLTGEFPGDYGWDTAGLS 87