BLASTX nr result
ID: Panax25_contig00007175
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00007175 (580 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN04928.1 hypothetical protein DCAR_005765 [Daucus carota subsp... 55 1e-06 KZN10244.1 hypothetical protein DCAR_002900 [Daucus carota subsp... 55 5e-06 XP_017229659.1 PREDICTED: universal stress protein PHOS32 [Daucu... 55 5e-06 >KZN04928.1 hypothetical protein DCAR_005765 [Daucus carota subsp. sativus] Length = 122 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -1 Query: 580 RILLGSVSDYCSKHVKCPTVIVKKSKNQKKIE 485 R L+GSVS+YCSKHVKCPTV+VK+ KN+K +E Sbjct: 90 RTLVGSVSNYCSKHVKCPTVVVKQPKNEKLVE 121 >KZN10244.1 hypothetical protein DCAR_002900 [Daucus carota subsp. sativus] Length = 166 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -1 Query: 580 RILLGSVSDYCSKHVKCPTVIVKKSKNQKKIE 485 R LLGSVSDYCSK+VKCPTV+VK+ KN+K ++ Sbjct: 132 RTLLGSVSDYCSKNVKCPTVVVKQPKNEKNLD 163 >XP_017229659.1 PREDICTED: universal stress protein PHOS32 [Daucus carota subsp. sativus] Length = 171 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -1 Query: 580 RILLGSVSDYCSKHVKCPTVIVKKSKNQKKIE 485 R LLGSVSDYCSK+VKCPTV+VK+ KN+K ++ Sbjct: 137 RTLLGSVSDYCSKNVKCPTVVVKQPKNEKNLD 168