BLASTX nr result
ID: Panax25_contig00006993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00006993 (791 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016496811.1 PREDICTED: thioredoxin O2, mitochondrial, partial... 64 2e-09 XP_009793201.1 PREDICTED: thioredoxin O1, mitochondrial-like [Ni... 64 4e-09 CAN74552.1 hypothetical protein VITISV_019041 [Vitis vinifera] 64 6e-09 XP_011096833.1 PREDICTED: thioredoxin O2, mitochondrial [Sesamum... 64 7e-09 XP_016505882.1 PREDICTED: thioredoxin O2, mitochondrial-like [Ni... 64 1e-08 XP_009599282.1 PREDICTED: thioredoxin O2, mitochondrial-like [Ni... 64 1e-08 XP_019170294.1 PREDICTED: thioredoxin O2, mitochondrial [Ipomoea... 63 2e-08 XP_019232382.1 PREDICTED: thioredoxin O2, mitochondrial-like [Ni... 63 2e-08 XP_002275152.1 PREDICTED: thioredoxin O2, mitochondrial [Vitis v... 62 5e-08 CBI27208.3 unnamed protein product, partial [Vitis vinifera] 62 8e-08 KZN06943.1 hypothetical protein DCAR_007780 [Daucus carota subsp... 59 1e-07 XP_006365059.1 PREDICTED: thioredoxin O2, mitochondrial-like [So... 61 1e-07 XP_015583986.1 PREDICTED: thioredoxin O2, mitochondrial isoform ... 60 1e-07 XP_016559188.1 PREDICTED: thioredoxin O2, mitochondrial-like [Ca... 60 2e-07 EEF27933.1 Thioredoxin I, putative [Ricinus communis] 60 2e-07 XP_020080872.1 thioredoxin O1, mitochondrial-like [Ananas comosus] 57 3e-07 XP_015063248.1 PREDICTED: thioredoxin O2, mitochondrial-like [So... 59 4e-07 XP_004233256.1 PREDICTED: thioredoxin O2, mitochondrial [Solanum... 59 4e-07 XP_012087817.1 PREDICTED: thioredoxin O1, mitochondrial-like [Ja... 59 5e-07 XP_012829718.1 PREDICTED: thioredoxin O2, mitochondrial [Erythra... 59 6e-07 >XP_016496811.1 PREDICTED: thioredoxin O2, mitochondrial, partial [Nicotiana tabacum] Length = 112 Score = 63.5 bits (153), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKK SEVIGADVQRLKDT+E+LYK Sbjct: 81 PTLHFFQNGKKTSEVIGADVQRLKDTMEELYK 112 >XP_009793201.1 PREDICTED: thioredoxin O1, mitochondrial-like [Nicotiana sylvestris] Length = 138 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKK SEVIGADVQRLKDT+E+LYK Sbjct: 107 PTLHFFQNGKKTSEVIGADVQRLKDTMEELYK 138 >CAN74552.1 hypothetical protein VITISV_019041 [Vitis vinifera] Length = 152 Score = 63.5 bits (153), Expect = 6e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 243 QPTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 QPTLHFFQNGKKA+E+IGADV RLKDT++KLYK Sbjct: 120 QPTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 152 >XP_011096833.1 PREDICTED: thioredoxin O2, mitochondrial [Sesamum indicum] Length = 193 Score = 64.3 bits (155), Expect = 7e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKKASEVIGADVQRLKDT+E LYK Sbjct: 162 PTLHFFQNGKKASEVIGADVQRLKDTMEALYK 193 >XP_016505882.1 PREDICTED: thioredoxin O2, mitochondrial-like [Nicotiana tabacum] Length = 198 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKK SEVIGADVQRLKDT+E+LYK Sbjct: 167 PTLHFFQNGKKTSEVIGADVQRLKDTMEELYK 198 >XP_009599282.1 PREDICTED: thioredoxin O2, mitochondrial-like [Nicotiana tomentosiformis] Length = 198 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKK SEVIGADVQRLKDT+E+LYK Sbjct: 167 PTLHFFQNGKKTSEVIGADVQRLKDTMEELYK 198 >XP_019170294.1 PREDICTED: thioredoxin O2, mitochondrial [Ipomoea nil] Length = 190 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKKASEVIGADVQ+LKDT+E LYK Sbjct: 159 PTLHFFQNGKKASEVIGADVQKLKDTMEALYK 190 >XP_019232382.1 PREDICTED: thioredoxin O2, mitochondrial-like [Nicotiana attenuata] OIT06674.1 thioredoxin o1, mitochondrial [Nicotiana attenuata] Length = 198 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKK SEV+GADVQRLKDT+E+LYK Sbjct: 167 PTLHFFQNGKKTSEVVGADVQRLKDTMEELYK 198 >XP_002275152.1 PREDICTED: thioredoxin O2, mitochondrial [Vitis vinifera] XP_003631244.1 PREDICTED: thioredoxin O2, mitochondrial-like isoform X1 [Vitis vinifera] CBI27209.3 unnamed protein product, partial [Vitis vinifera] Length = 186 Score = 61.6 bits (148), Expect = 5e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKKA+E+IGADV RLKDT++KLYK Sbjct: 153 PTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 184 >CBI27208.3 unnamed protein product, partial [Vitis vinifera] Length = 208 Score = 61.6 bits (148), Expect = 8e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKKA+E+IGADV RLKDT++KLYK Sbjct: 175 PTLHFFQNGKKAAEIIGADVARLKDTMDKLYK 206 >KZN06943.1 hypothetical protein DCAR_007780 [Daucus carota subsp. sativus] Length = 96 Score = 58.5 bits (140), Expect = 1e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 P LHFF NG+KASEV+GADV+R+KDT+EKLYK Sbjct: 65 PRLHFFHNGEKASEVVGADVERIKDTMEKLYK 96 >XP_006365059.1 PREDICTED: thioredoxin O2, mitochondrial-like [Solanum tuberosum] Length = 194 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHF+QNGKK SEVIGADVQRLK+T+E+LYK Sbjct: 163 PTLHFYQNGKKTSEVIGADVQRLKETMEELYK 194 >XP_015583986.1 PREDICTED: thioredoxin O2, mitochondrial isoform X2 [Ricinus communis] Length = 189 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -3 Query: 255 FLLLQPTLHFFQNGKKASEVIGADVQRLKDTVEKLY 148 F+ PTLHFFQNGKKA+E++GADV+R+KDT+E+LY Sbjct: 151 FISAVPTLHFFQNGKKAAEIVGADVERIKDTMEELY 186 >XP_016559188.1 PREDICTED: thioredoxin O2, mitochondrial-like [Capsicum annuum] Length = 196 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKK SEVIGADVQ LKDT+E+LYK Sbjct: 165 PTLHFFQNGKKTSEVIGADVQCLKDTMEELYK 196 >EEF27933.1 Thioredoxin I, putative [Ricinus communis] Length = 206 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -3 Query: 255 FLLLQPTLHFFQNGKKASEVIGADVQRLKDTVEKLY 148 F+ PTLHFFQNGKKA+E++GADV+R+KDT+E+LY Sbjct: 168 FISAVPTLHFFQNGKKAAEIVGADVERIKDTMEELY 203 >XP_020080872.1 thioredoxin O1, mitochondrial-like [Ananas comosus] Length = 96 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNG+KASE+IGADV++L+ T+EKLYK Sbjct: 65 PTLHFFQNGQKASEIIGADVRQLETTMEKLYK 96 >XP_015063248.1 PREDICTED: thioredoxin O2, mitochondrial-like [Solanum pennellii] Length = 194 Score = 59.3 bits (142), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKK SEVIGADVQ LK+T+E+LYK Sbjct: 163 PTLHFFQNGKKTSEVIGADVQLLKETMEELYK 194 >XP_004233256.1 PREDICTED: thioredoxin O2, mitochondrial [Solanum lycopersicum] Length = 194 Score = 59.3 bits (142), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKK SEVIGADVQ LK+T+E+LYK Sbjct: 163 PTLHFFQNGKKTSEVIGADVQLLKETMEELYK 194 >XP_012087817.1 PREDICTED: thioredoxin O1, mitochondrial-like [Jatropha curcas] KDP24585.1 hypothetical protein JCGZ_26541 [Jatropha curcas] Length = 191 Score = 58.9 bits (141), Expect = 5e-07 Identities = 24/31 (77%), Positives = 31/31 (100%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLY 148 PTLHFF+NGKKA+E++GADV+RLKDT+E+LY Sbjct: 157 PTLHFFENGKKAAEIVGADVERLKDTMEELY 187 >XP_012829718.1 PREDICTED: thioredoxin O2, mitochondrial [Erythranthe guttata] EYU43654.1 hypothetical protein MIMGU_mgv1a014274mg [Erythranthe guttata] Length = 195 Score = 58.9 bits (141), Expect = 6e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 240 PTLHFFQNGKKASEVIGADVQRLKDTVEKLYK 145 PTLHFFQNGKKASEV+GADV+ +KDT+E LYK Sbjct: 164 PTLHFFQNGKKASEVVGADVELVKDTMETLYK 195