BLASTX nr result
ID: Panax25_contig00006984
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00006984 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI05138.1 hypothetical protein Ccrd_016530 [Cynara cardunculus ... 53 6e-06 >KVI05138.1 hypothetical protein Ccrd_016530 [Cynara cardunculus var. scolymus] Length = 165 Score = 52.8 bits (125), Expect = 6e-06 Identities = 21/37 (56%), Positives = 33/37 (89%) Frame = +1 Query: 271 MLKKKKGEKDGSSTSYMDLKSQKMEIRSIMKDIEFLG 381 M K+K+G K+ + T+YMD+KSQ+ME++SI+KDIE++G Sbjct: 1 MAKRKQGNKEEAMTTYMDMKSQRMELKSILKDIEYMG 37