BLASTX nr result
ID: Panax25_contig00006834
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00006834 (766 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017223689.1 PREDICTED: 30S ribosomal protein 3-1, chloroplast... 55 9e-06 >XP_017223689.1 PREDICTED: 30S ribosomal protein 3-1, chloroplastic-like [Daucus carota subsp. sativus] KZM85854.1 hypothetical protein DCAR_026724 [Daucus carota subsp. sativus] Length = 172 Score = 55.1 bits (131), Expect = 9e-06 Identities = 33/54 (61%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -2 Query: 414 VQSGIKGSFTCPSFPSQKPSSYSVKHQAFC-RHSSTIFVLKSRPIRRIDSLCAS 256 VQSGIKGSFT PSFP S +VKHQA H S F +KS+P RRI SLC S Sbjct: 6 VQSGIKGSFTRPSFP-----SCNVKHQALALPHFSQSFGVKSKPFRRIRSLCVS 54