BLASTX nr result
ID: Panax25_contig00006798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00006798 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW20223.1 hypothetical protein TanjilG_07314 [Lupinus angustifo... 89 2e-20 XP_006379623.1 hypothetical protein POPTR_0008s06570g [Populus t... 92 4e-20 XP_012858657.1 PREDICTED: eukaryotic translation initiation fact... 92 1e-19 CDP14052.1 unnamed protein product [Coffea canephora] 92 1e-19 XP_012087805.1 PREDICTED: eukaryotic translation initiation fact... 91 3e-19 XP_011076724.1 PREDICTED: eukaryotic translation initiation fact... 91 3e-19 XP_002526864.1 PREDICTED: eukaryotic translation initiation fact... 91 3e-19 XP_010534569.1 PREDICTED: eukaryotic translation initiation fact... 91 4e-19 XP_019180760.1 PREDICTED: eukaryotic translation initiation fact... 90 4e-19 XP_013748049.1 PREDICTED: eukaryotic translation initiation fact... 90 5e-19 CDX74814.1 BnaA05g05600D [Brassica napus] 90 5e-19 XP_013633609.1 PREDICTED: eukaryotic translation initiation fact... 90 5e-19 OAY46221.1 hypothetical protein MANES_07G126500 [Manihot esculenta] 91 5e-19 JAU15777.1 Eukaryotic translation initiation factor 3 subunit F,... 91 5e-19 XP_019578735.1 PREDICTED: eukaryotic translation initiation fact... 90 5e-19 XP_018434302.1 PREDICTED: eukaryotic translation initiation fact... 90 5e-19 OAP09940.1 eIF3F [Arabidopsis thaliana] 90 5e-19 NP_181528.1 eukaryotic translation initiation factor 2 [Arabidop... 90 5e-19 XP_010508936.1 PREDICTED: eukaryotic translation initiation fact... 90 5e-19 XP_010505700.1 PREDICTED: eukaryotic translation initiation fact... 90 5e-19 >OIW20223.1 hypothetical protein TanjilG_07314 [Lupinus angustifolius] Length = 89 Score = 88.6 bits (218), Expect = 2e-20 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD +VRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNES DQ ++ Sbjct: 31 FNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESVDQVLL 80 >XP_006379623.1 hypothetical protein POPTR_0008s06570g [Populus trichocarpa] ERP57420.1 hypothetical protein POPTR_0008s06570g [Populus trichocarpa] Length = 229 Score = 91.7 bits (226), Expect = 4e-20 Identities = 41/52 (78%), Positives = 49/52 (94%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIVVG 244 ++ CD +VRRPDQAERVIGTLLGSVLPDGTVDIRNS+AVPHNESS+ +++VG Sbjct: 30 FNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSHAVPHNESSEHEVIVG 81 >XP_012858657.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Erythranthe guttata] EYU19987.1 hypothetical protein MIMGU_mgv1a011358mg [Erythranthe guttata] Length = 284 Score = 91.7 bits (226), Expect = 1e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 259 Y+ CD +VRRPDQAERVIGTLLGSVLPDGT+DIRNSYAVPHNESSDQ Sbjct: 28 YNICDCYVRRPDQAERVIGTLLGSVLPDGTIDIRNSYAVPHNESSDQ 74 >CDP14052.1 unnamed protein product [Coffea canephora] Length = 285 Score = 91.7 bits (226), Expect = 1e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 259 ++ CD FVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ Sbjct: 28 FNICDCFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 74 >XP_012087805.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Jatropha curcas] KDP44817.1 hypothetical protein JCGZ_01317 [Jatropha curcas] Length = 283 Score = 90.5 bits (223), Expect = 3e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 259 ++ CD +VRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ Sbjct: 26 FNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 72 >XP_011076724.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Sesamum indicum] Length = 284 Score = 90.5 bits (223), Expect = 3e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 259 ++ CD +VRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ Sbjct: 28 FNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 74 >XP_002526864.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Ricinus communis] EEF35495.1 eukaryotic translation initiation factor 3f, eif3f, putative [Ricinus communis] Length = 287 Score = 90.5 bits (223), Expect = 3e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 259 ++ CD +VRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ Sbjct: 30 FNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 76 >XP_010534569.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Tarenaya hassleriana] Length = 296 Score = 90.5 bits (223), Expect = 4e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 259 ++ CD +VRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ Sbjct: 39 FNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 85 >XP_019180760.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Ipomoea nil] Length = 286 Score = 90.1 bits (222), Expect = 4e-19 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 259 ++ CD FVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNES DQ Sbjct: 29 FNICDCFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESQDQ 75 >XP_013748049.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Brassica napus] Length = 289 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGS+LPDGTVDIRNSYAVPHNESSDQ V Sbjct: 32 FNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 81 >CDX74814.1 BnaA05g05600D [Brassica napus] Length = 289 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGS+LPDGTVDIRNSYAVPHNESSDQ V Sbjct: 32 FNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 81 >XP_013633609.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Brassica oleracea var. oleracea] CDY65775.1 BnaC04g53310D [Brassica napus] Length = 289 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGS+LPDGTVDIRNSYAVPHNESSDQ V Sbjct: 32 FNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 81 >OAY46221.1 hypothetical protein MANES_07G126500 [Manihot esculenta] Length = 315 Score = 90.5 bits (223), Expect = 5e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 259 ++ CD +VRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ Sbjct: 30 FNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ 76 >JAU15777.1 Eukaryotic translation initiation factor 3 subunit F, partial [Noccaea caerulescens] Length = 316 Score = 90.5 bits (223), Expect = 5e-19 Identities = 43/50 (86%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQ V Sbjct: 59 FNVCDCFVRRPDSAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQVAV 108 >XP_019578735.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Rhinolophus sinicus] Length = 293 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGS+LPDGTVDIRNSYAVPHNESSDQ V Sbjct: 36 FNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85 >XP_018434302.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Raphanus sativus] Length = 293 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGS+LPDGTVDIRNSYAVPHNESSDQ V Sbjct: 36 FNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85 >OAP09940.1 eIF3F [Arabidopsis thaliana] Length = 293 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGS+LPDGTVDIRNSYAVPHNESSDQ V Sbjct: 36 FNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85 >NP_181528.1 eukaryotic translation initiation factor 2 [Arabidopsis thaliana] O04202.1 RecName: Full=Eukaryotic translation initiation factor 3 subunit F; Short=eIF3f; AltName: Full=eIF-3-epsilon; AltName: Full=eIF3 p32 subunit AAB95284.1 26S proteasome regulatory subunit [Arabidopsis thaliana] AAD03463.1 translation initiation factor eIF2 p47 subunit homolog [Arabidopsis thaliana] AAK76498.1 putative 26S proteasome regulatory subunit [Arabidopsis thaliana] AAM14302.1 putative 26S proteasome regulatory subunit [Arabidopsis thaliana] AEC09760.1 eukaryotic translation initiation factor 2 [Arabidopsis thaliana] Length = 293 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGS+LPDGTVDIRNSYAVPHNESSDQ V Sbjct: 36 FNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85 >XP_010508936.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Camelina sativa] Length = 293 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGS+LPDGTVDIRNSYAVPHNESSDQ V Sbjct: 36 FNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85 >XP_010505700.1 PREDICTED: eukaryotic translation initiation factor 3 subunit F [Camelina sativa] Length = 293 Score = 90.1 bits (222), Expect = 5e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 399 YSTCDYFVRRPDQAERVIGTLLGSVLPDGTVDIRNSYAVPHNESSDQKIV 250 ++ CD FVRRPD AERVIGTLLGS+LPDGTVDIRNSYAVPHNESSDQ V Sbjct: 36 FNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85