BLASTX nr result
ID: Panax25_contig00006553
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00006553 (580 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249361.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 91 5e-18 XP_002265275.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 87 7e-17 CBI28465.3 unnamed protein product, partial [Vitis vinifera] 83 2e-15 XP_004144552.2 PREDICTED: indole-3-glycerol phosphate synthase, ... 76 9e-13 XP_019167188.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 73 8e-12 XP_011071996.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 72 1e-11 XP_008462039.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 70 1e-10 XP_010243967.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 68 4e-10 XP_018848755.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 67 8e-10 XP_010048244.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 66 3e-09 XP_012829337.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 65 4e-09 XP_010466995.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 65 4e-09 XP_010514497.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 65 4e-09 XP_002883637.1 hypothetical protein ARALYDRAFT_480086 [Arabidops... 65 5e-09 XP_010088356.1 Indole-3-glycerol phosphate synthase [Morus notab... 65 7e-09 XP_012081510.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 65 7e-09 JAU38073.1 Indole-3-glycerol phosphate synthase, chloroplastic [... 65 7e-09 CDP12683.1 unnamed protein product [Coffea canephora] 64 9e-09 JAU63446.1 Indole-3-glycerol phosphate synthase, chloroplastic [... 64 9e-09 XP_010272647.1 PREDICTED: indole-3-glycerol phosphate synthase, ... 64 1e-08 >XP_017249361.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Daucus carota subsp. sativus] KZM96429.1 hypothetical protein DCAR_019671 [Daucus carota subsp. sativus] Length = 401 Score = 90.5 bits (223), Expect = 5e-18 Identities = 53/109 (48%), Positives = 72/109 (66%) Frame = +2 Query: 254 SMRETPIGIRVPSSYLNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNKLSVPSRI 433 ++R P G+RV +L SLH+ A I F RSI YI G + Y ++KL + S + Sbjct: 3 ALRANPTGLRVSPLHLKPSLHKSAAL--IRFPRSIGYISGGI------YYSSKLPMRSSV 54 Query: 434 RAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 RAQQ ELKDG+E+VS GSDSE + +K+ EW+ ++QDE+A QGIRIRR Sbjct: 55 RAQQ-ELKDGAEVVSGGSDSEGEEIKV-EWDGAKYQDEIAEAQGIRIRR 101 >XP_002265275.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic [Vitis vinifera] Length = 396 Score = 87.4 bits (215), Expect = 7e-17 Identities = 59/114 (51%), Positives = 70/114 (61%) Frame = +2 Query: 239 MEGVISMRETPIGIRVPSSYLNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNKLS 418 MEG+ S+R TP RV ++ H+P I G M +S KLS Sbjct: 1 MEGLFSLRATP---RVLVPTVSAPNHKPKFS-----------ISGTRMEVQKS---KKLS 43 Query: 419 VPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 V +RAQQSE KDGS VSP SDS+ +ALKIKEWE+GRFQDE+AATQGIRIRR Sbjct: 44 VAC-VRAQQSESKDGSATVSPLSDSQENALKIKEWEVGRFQDEIAATQGIRIRR 96 >CBI28465.3 unnamed protein product, partial [Vitis vinifera] Length = 363 Score = 83.2 bits (204), Expect = 2e-15 Identities = 44/59 (74%), Positives = 50/59 (84%) Frame = +2 Query: 404 TNKLSVPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 + KLSV +RAQQSE KDGS VSP SDS+ +ALKIKEWE+GRFQDE+AATQGIRIRR Sbjct: 6 SKKLSVAC-VRAQQSESKDGSATVSPLSDSQENALKIKEWEVGRFQDEIAATQGIRIRR 63 >XP_004144552.2 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic [Cucumis sativus] KGN43401.1 hypothetical protein Csa_7G031620 [Cucumis sativus] Length = 411 Score = 75.9 bits (185), Expect = 9e-13 Identities = 51/119 (42%), Positives = 68/119 (57%), Gaps = 5/119 (4%) Frame = +2 Query: 239 MEGVISMRETPIGIRVPSSYLNQSLHRPTAFGAITFRRSINYIPG---ALMGEPRSYNTN 409 MEG+ S+R P VP ++ S R R +N P +L +++ Sbjct: 1 MEGLASLRTIP---NVPFQPISSSTRRSKFLS-----RRLNLGPSMDSSLRNSITLTSSS 52 Query: 410 KLSVP--SRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 S P + IRAQQ E + GS SPG++SE +ALK+KEWE+G FQDE+AATQGIRIRR Sbjct: 53 SSSSPMFTAIRAQQIESEAGSAAASPGTESEENALKVKEWEVGMFQDEVAATQGIRIRR 111 >XP_019167188.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Ipomoea nil] Length = 404 Score = 73.2 bits (178), Expect = 8e-12 Identities = 44/90 (48%), Positives = 56/90 (62%), Gaps = 8/90 (8%) Frame = +2 Query: 335 AITFRRSINYIP--------GALMGEPRSYNTNKLSVPSRIRAQQSELKDGSEIVSPGSD 490 A++FR IN P GALM P+ + + S IRAQQ +LK+ S +S + Sbjct: 19 AVSFRTPINLTPKRFGFSSAGALMSNPKRISLSC----SPIRAQQPDLKEESATLSESNI 74 Query: 491 SEVDALKIKEWELGRFQDELAATQGIRIRR 580 SE +ALKIKEWE+ R QDE+AA QGIRIRR Sbjct: 75 SEAEALKIKEWEVQRLQDEVAANQGIRIRR 104 >XP_011071996.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like isoform X1 [Sesamum indicum] Length = 409 Score = 72.4 bits (176), Expect = 1e-11 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = +2 Query: 410 KLSVPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 +LS+P+ I++QQ ELKDGS VS SE DALK+KEWE+G FQDE+AA+QGI+IRR Sbjct: 54 QLSLPA-IKSQQFELKDGSATVSETKTSEGDALKVKEWEVGMFQDEVAASQGIKIRR 109 >XP_008462039.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic [Cucumis melo] Length = 412 Score = 69.7 bits (169), Expect = 1e-10 Identities = 36/62 (58%), Positives = 48/62 (77%) Frame = +2 Query: 395 SYNTNKLSVPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRI 574 S +++ +S P IRAQQ E + GS SP ++SE +ALK+KEWE+G FQDE+AA+QGIRI Sbjct: 53 SSSSSPMSTP--IRAQQIESETGSAAASPVTESEENALKVKEWEVGMFQDEVAASQGIRI 110 Query: 575 RR 580 RR Sbjct: 111 RR 112 >XP_010243967.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Nelumbo nucifera] Length = 396 Score = 68.2 bits (165), Expect = 4e-10 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +2 Query: 431 IRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 IRAQQS KDG + P DS+ +AL+IKEWE+GRFQDE+AA+ GIRIRR Sbjct: 47 IRAQQSNSKDGYSTLPPMDDSKGNALEIKEWEVGRFQDEIAASHGIRIRR 96 >XP_018848755.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Juglans regia] Length = 397 Score = 67.4 bits (163), Expect = 8e-10 Identities = 48/116 (41%), Positives = 60/116 (51%), Gaps = 2/116 (1%) Frame = +2 Query: 239 MEGVISMRETPIGIRVPSSYLNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNKLS 418 MEG++ +R L HRP F RRSI G P ++ Sbjct: 1 MEGLVFLRPA----------LPSLTHRPNQFSR---RRSIP-------GTPMDFHIRNSG 40 Query: 419 --VPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 S IRAQQ E KDGS VS + S +ALKIKEWE+G F +E+AA+QGI+IRR Sbjct: 41 PFASSSIRAQQLESKDGSATVSQAAVSAENALKIKEWEVGMFHNEVAASQGIKIRR 96 >XP_010048244.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic isoform X1 [Eucalyptus grandis] XP_010048251.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic isoform X1 [Eucalyptus grandis] KCW89040.1 hypothetical protein EUGRSUZ_A01368 [Eucalyptus grandis] Length = 402 Score = 65.9 bits (159), Expect = 3e-09 Identities = 50/115 (43%), Positives = 65/115 (56%), Gaps = 1/115 (0%) Frame = +2 Query: 239 MEGVISMRETPIGIRVPSSYLNQSLHRPTAFGAITFRRSI-NYIPGALMGEPRSYNTNKL 415 MEG++S R T VP + +HRP + SI +P A M KL Sbjct: 1 MEGLVSFRATA---GVPFYGVPSLMHRPA-------KSSICRLLPIAAMD--LHAKERKL 48 Query: 416 SVPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 SV S IRAQQSE D S V ++S+ ++L K+WELG +QDE+AA+QGIRIRR Sbjct: 49 SV-SCIRAQQSETSDISATVVSANESQENSLNAKDWELGMYQDEVAASQGIRIRR 102 >XP_012829337.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Erythranthe guttata] EYU17750.1 hypothetical protein MIMGU_mgv1a007580mg [Erythranthe guttata] Length = 403 Score = 65.5 bits (158), Expect = 4e-09 Identities = 48/116 (41%), Positives = 66/116 (56%), Gaps = 2/116 (1%) Frame = +2 Query: 239 MEGVISMR--ETPIGIRVPSSYLNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNK 412 MEGVIS+R +P I SS +SL TF R+ P ++ N+ Sbjct: 1 MEGVISLRVSSSPAIISKHSSSSQRSLS--LILPKSTFFRT----------SPLTHMPNQ 48 Query: 413 LSVPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 SV S +++QQ ELKDG S S+ DALK+K+WE+G Q+E+AA+QGI+IRR Sbjct: 49 FSVFS-VKSQQYELKDGPATFSDTRISDRDALKVKDWEIGMLQEEVAASQGIKIRR 103 >XP_010466995.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic [Camelina sativa] Length = 404 Score = 65.5 bits (158), Expect = 4e-09 Identities = 41/114 (35%), Positives = 66/114 (57%) Frame = +2 Query: 239 MEGVISMRETPIGIRVPSSYLNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNKLS 418 MEG++ ++ P+ + PS Y ++ +++ RRS++ G M + + S Sbjct: 1 MEGLVPVQRLPLRVASPSLYRYSNV-------SVSIRRSLS---GFAMDKRIRFTAP--S 48 Query: 419 VPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 IRAQQS+LK+ + S + + +AL+IKEWE+ +QDELA +QGIRIRR Sbjct: 49 SEFSIRAQQSDLKESLVVSSSSVEDKGNALRIKEWEVEMYQDELAVSQGIRIRR 102 >XP_010514497.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Camelina sativa] Length = 405 Score = 65.5 bits (158), Expect = 4e-09 Identities = 41/114 (35%), Positives = 66/114 (57%) Frame = +2 Query: 239 MEGVISMRETPIGIRVPSSYLNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNKLS 418 MEG++ ++ P+ + PS Y ++ +++ RRS++ G M + + S Sbjct: 1 MEGLVPVQRLPVRVDSPSLYRCSNV-------SVSIRRSLS---GFAMDKRIRFTAP--S 48 Query: 419 VPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 IRAQQS+LK+ + S + + +AL+IKEWE+ +QDELA +QGIRIRR Sbjct: 49 SQFSIRAQQSDLKESLAVSSSSVEDKGNALRIKEWEVEMYQDELAVSQGIRIRR 102 >XP_002883637.1 hypothetical protein ARALYDRAFT_480086 [Arabidopsis lyrata subsp. lyrata] EFH59896.1 hypothetical protein ARALYDRAFT_480086 [Arabidopsis lyrata subsp. lyrata] Length = 402 Score = 65.1 bits (157), Expect = 5e-09 Identities = 40/115 (34%), Positives = 62/115 (53%), Gaps = 1/115 (0%) Frame = +2 Query: 239 MEGVISMRETPIGIRVPSSY-LNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNKL 415 MEG++ ++ P+ + PS Y N S+ + R IN+ P ++ Sbjct: 1 MEGLVPVQRLPVRVASPSLYRCNNSISIRRSISGFAMDRKINF------RAPPQFS---- 50 Query: 416 SVPSRIRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 IRAQQS+LK+ + S + + +AL+IKEWE+ +Q+ELA +QGIRIRR Sbjct: 51 -----IRAQQSDLKESLAVSSSSVEDKGNALRIKEWEVEMYQEELAISQGIRIRR 100 >XP_010088356.1 Indole-3-glycerol phosphate synthase [Morus notabilis] EXB34474.1 Indole-3-glycerol phosphate synthase [Morus notabilis] Length = 394 Score = 64.7 bits (156), Expect = 7e-09 Identities = 37/57 (64%), Positives = 45/57 (78%), Gaps = 2/57 (3%) Frame = +2 Query: 416 SVPSRIRAQQSELKDGSEIVSPGS-DSEVD-ALKIKEWELGRFQDELAATQGIRIRR 580 S P IRAQQ E KDGS V+P S DSE + +L+IKEWE+G FQ+E+AA+QGIRIRR Sbjct: 38 SSPFAIRAQQMESKDGSATVTPISEDSESENSLEIKEWEVGMFQNEVAASQGIRIRR 94 >XP_012081510.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic [Jatropha curcas] Length = 398 Score = 64.7 bits (156), Expect = 7e-09 Identities = 49/121 (40%), Positives = 69/121 (57%), Gaps = 7/121 (5%) Frame = +2 Query: 239 MEGVISMRETPIGIRV-PSSYLNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNKL 415 MEG++S R + I++ P+ Y HRP + +RS+N G N+ Sbjct: 1 MEGLVSPR---VSIKITPALY-----HRPK----FSIKRSMNLHTGV----------NRF 38 Query: 416 SVPSRIRAQQSELKDGSEIVSPGSDSEV------DALKIKEWELGRFQDELAATQGIRIR 577 SV S I+AQQ+E K+GS VS EV +AL++KEWE+G Q+E+AA+QGIRIR Sbjct: 39 SVAS-IKAQQAETKEGSATVSAAVKEEVPAATVENALEVKEWEVGMLQNEVAASQGIRIR 97 Query: 578 R 580 R Sbjct: 98 R 98 >JAU38073.1 Indole-3-glycerol phosphate synthase, chloroplastic [Noccaea caerulescens] Length = 411 Score = 64.7 bits (156), Expect = 7e-09 Identities = 44/116 (37%), Positives = 69/116 (59%), Gaps = 2/116 (1%) Frame = +2 Query: 239 MEGVISMRETPIGIRVPSSYLNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNKLS 418 MEG+I ++ G R+P ++ SL+R G+++ RRS++ P R N S Sbjct: 1 MEGLIPVQSA--GQRLPVRLVSPSLYRSIG-GSVSIRRSVSGFP-----MDRKINFRAPS 52 Query: 419 VPSRIRAQQSELKDGSEIV--SPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 + IRAQQS+LK+ + S S S +A++IKEWE+ +Q+E+A +QG+RIRR Sbjct: 53 L-FPIRAQQSDLKESLSVAAASSSSSSVENAIRIKEWEVDMYQNEIAISQGVRIRR 107 >CDP12683.1 unnamed protein product [Coffea canephora] Length = 393 Score = 64.3 bits (155), Expect = 9e-09 Identities = 38/88 (43%), Positives = 54/88 (61%) Frame = +2 Query: 317 RPTAFGAITFRRSINYIPGALMGEPRSYNTNKLSVPSRIRAQQSELKDGSEIVSPGSDSE 496 R A +I + + + +G ++NT P I+AQ+SELK+ S ++ E Sbjct: 16 RVVALQSIHLKPRLRFFKPTPVGSSMAHNT-----PLSIQAQKSELKEASAEIT-----E 65 Query: 497 VDALKIKEWELGRFQDELAATQGIRIRR 580 DALKIKEWE+G F+DE+AA+QGIRIRR Sbjct: 66 RDALKIKEWEVGMFRDEVAASQGIRIRR 93 >JAU63446.1 Indole-3-glycerol phosphate synthase, chloroplastic [Noccaea caerulescens] Length = 411 Score = 64.3 bits (155), Expect = 9e-09 Identities = 43/116 (37%), Positives = 69/116 (59%), Gaps = 2/116 (1%) Frame = +2 Query: 239 MEGVISMRETPIGIRVPSSYLNQSLHRPTAFGAITFRRSINYIPGALMGEPRSYNTNKLS 418 MEG+I ++ G R+P ++ SL+R G+++ RRS++ P R N S Sbjct: 1 MEGLIPVQSA--GQRLPVRLVSPSLYRSIG-GSVSIRRSVSGFP-----MDRKINFRAPS 52 Query: 419 VPSRIRAQQSELKDGSEIVSPGSDSEV--DALKIKEWELGRFQDELAATQGIRIRR 580 + IRAQQS+LK+ + + S S +A++IKEWE+ +Q+E+A +QG+RIRR Sbjct: 53 L-FPIRAQQSDLKESLSVAAAASSSSSVENAIRIKEWEVDMYQNEIAISQGVRIRR 107 >XP_010272647.1 PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like isoform X3 [Nelumbo nucifera] Length = 387 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = +2 Query: 431 IRAQQSELKDGSEIVSPGSDSEVDALKIKEWELGRFQDELAATQGIRIRR 580 IRAQQS KDG+ + P DS+ +AL+IKEWE GR DE+A++QGIRIRR Sbjct: 44 IRAQQSASKDGNSTLPPMVDSKANALEIKEWEAGRLIDEIASSQGIRIRR 93