BLASTX nr result
ID: Panax25_contig00006382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00006382 (402 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247215.1 PREDICTED: probable amino-acid racemase [Daucus c... 58 3e-07 >XP_017247215.1 PREDICTED: probable amino-acid racemase [Daucus carota subsp. sativus] KZM97768.1 hypothetical protein DCAR_014870 [Daucus carota subsp. sativus] Length = 336 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 127 MQNHWLQNSSRMFDGVMKISFNTLICPQVRVGNLSKKRA 11 MQN+WL S MFDGVM+ SFNTL CPQV V N++K+RA Sbjct: 1 MQNYWLHKSLGMFDGVMRSSFNTLNCPQVHVRNVNKRRA 39