BLASTX nr result
ID: Panax25_contig00006195
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00006195 (389 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EON88778.1 membrane-bound proton-translocating pyrophosphatase, ... 59 2e-09 XP_010654944.1 PREDICTED: pyrophosphate-energized vacuolar membr... 60 3e-09 JAU33916.1 Pyrophosphate-energized vacuolar membrane proton pump... 59 6e-09 JAU64016.1 Pyrophosphate-energized vacuolar membrane proton pump... 59 6e-09 XP_008242846.2 PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-ene... 62 1e-08 XP_009385121.1 PREDICTED: pyrophosphate-energized vacuolar membr... 61 3e-08 OIT33043.1 pyrophosphate-energized vacuolar membrane proton pump... 59 4e-08 ABK94904.1 unknown [Populus trichocarpa] 60 4e-08 CBI36400.3 unnamed protein product, partial [Vitis vinifera] 60 5e-08 KDO47416.1 hypothetical protein CISIN_1g0042302mg, partial [Citr... 60 5e-08 KVI11691.1 Pyrophosphate-energised proton pump [Cynara carduncul... 60 5e-08 KHG11819.1 Pyrophosphate-energized vacuolar membrane proton pump... 60 5e-08 ONK60265.1 uncharacterized protein A4U43_C08F16220 [Asparagus of... 60 5e-08 KRH44487.1 hypothetical protein GLYMA_08G214300 [Glycine max] 60 5e-08 XP_012474373.1 PREDICTED: pyrophosphate-energized vacuolar membr... 60 5e-08 KHN01313.1 Pyrophosphate-energized vacuolar membrane proton pump... 60 5e-08 KDO47417.1 hypothetical protein CISIN_1g0042302mg, partial [Citr... 60 5e-08 XP_015573795.1 PREDICTED: pyrophosphate-energized vacuolar membr... 60 5e-08 OAY78536.1 Pyrophosphate-energized vacuolar membrane proton pump... 60 5e-08 AKT94843.1 Pyrophosphate-energized vacuolar membrane proton pump... 60 5e-08 >EON88778.1 membrane-bound proton-translocating pyrophosphatase, partial [Plesiomonas shigelloides 302-73] Length = 54 Score = 59.3 bits (142), Expect = 2e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGG+LFKIF Sbjct: 26 NILIKLMAVESLVFAPFFATHGGILFKIF 54 >XP_010654944.1 PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Vitis vinifera] Length = 111 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 83 NILIKLMAVESLVFAPFFATHGGLLFKIF 111 >JAU33916.1 Pyrophosphate-energized vacuolar membrane proton pump, partial [Noccaea caerulescens] Length = 77 Score = 58.5 bits (140), Expect = 6e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGG LFKIF Sbjct: 48 NILIKLMAVESLVFAPFFATHGGFLFKIF 76 >JAU64016.1 Pyrophosphate-energized vacuolar membrane proton pump, partial [Noccaea caerulescens] Length = 81 Score = 58.5 bits (140), Expect = 6e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGG LFKIF Sbjct: 52 NILIKLMAVESLVFAPFFATHGGFLFKIF 80 >XP_008242846.2 PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-energized vacuolar membrane proton pump [Prunus mume] Length = 1395 Score = 62.0 bits (149), Expect = 1e-08 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF*NKTSVSFPPNT 267 NILIKLMAVESLVFAPFFATHGGLLFKI TS PPN+ Sbjct: 738 NILIKLMAVESLVFAPFFATHGGLLFKIS-TTTSPKSPPNS 777 >XP_009385121.1 PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Musa acuminata subsp. malaccensis] Length = 771 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF*N 297 NILIKLMAVESLVFAPFFATHGGLLFKIF N Sbjct: 739 NILIKLMAVESLVFAPFFATHGGLLFKIFWN 769 >OIT33043.1 pyrophosphate-energized vacuolar membrane proton pump [Nicotiana attenuata] Length = 183 Score = 58.9 bits (141), Expect = 4e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMA+ESLVFAPFFATHGGLLFK+F Sbjct: 155 NILIKLMAIESLVFAPFFATHGGLLFKLF 183 >ABK94904.1 unknown [Populus trichocarpa] Length = 288 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 260 NILIKLMAVESLVFAPFFATHGGLLFKIF 288 >CBI36400.3 unnamed protein product, partial [Vitis vinifera] Length = 395 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 367 NILIKLMAVESLVFAPFFATHGGLLFKIF 395 >KDO47416.1 hypothetical protein CISIN_1g0042302mg, partial [Citrus sinensis] Length = 602 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 574 NILIKLMAVESLVFAPFFATHGGLLFKIF 602 >KVI11691.1 Pyrophosphate-energised proton pump [Cynara cardunculus var. scolymus] Length = 659 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 631 NILIKLMAVESLVFAPFFATHGGLLFKIF 659 >KHG11819.1 Pyrophosphate-energized vacuolar membrane proton pump 1 -like protein [Gossypium arboreum] Length = 666 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 638 NILIKLMAVESLVFAPFFATHGGLLFKIF 666 >ONK60265.1 uncharacterized protein A4U43_C08F16220 [Asparagus officinalis] Length = 667 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 639 NILIKLMAVESLVFAPFFATHGGLLFKIF 667 >KRH44487.1 hypothetical protein GLYMA_08G214300 [Glycine max] Length = 667 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 639 NILIKLMAVESLVFAPFFATHGGLLFKIF 667 >XP_012474373.1 PREDICTED: pyrophosphate-energized vacuolar membrane proton pump isoform X2 [Gossypium raimondii] KJB23660.1 hypothetical protein B456_004G108700 [Gossypium raimondii] Length = 667 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 639 NILIKLMAVESLVFAPFFATHGGLLFKIF 667 >KHN01313.1 Pyrophosphate-energized vacuolar membrane proton pump [Glycine soja] Length = 667 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 639 NILIKLMAVESLVFAPFFATHGGLLFKIF 667 >KDO47417.1 hypothetical protein CISIN_1g0042302mg, partial [Citrus sinensis] Length = 682 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 654 NILIKLMAVESLVFAPFFATHGGLLFKIF 682 >XP_015573795.1 PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Ricinus communis] Length = 687 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 659 NILIKLMAVESLVFAPFFATHGGLLFKIF 687 >OAY78536.1 Pyrophosphate-energized vacuolar membrane proton pump [Ananas comosus] Length = 691 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 663 NILIKLMAVESLVFAPFFATHGGLLFKIF 691 >AKT94843.1 Pyrophosphate-energized vacuolar membrane proton pump family protein-2 [Populus tomentosa] Length = 740 Score = 60.1 bits (144), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -1 Query: 389 NILIKLMAVESLVFAPFFATHGGLLFKIF 303 NILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 712 NILIKLMAVESLVFAPFFATHGGLLFKIF 740