BLASTX nr result
ID: Panax25_contig00005750
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00005750 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK63994.1 uncharacterized protein A4U43_C07F21020 [Asparagus of... 57 6e-07 XP_010255329.1 PREDICTED: signal peptide peptidase-like 4 [Nelum... 54 7e-06 OAY81126.1 Signal peptide peptidase-like 5 [Ananas comosus] 53 1e-05 XP_020112959.1 signal peptide peptidase-like 4 [Ananas comosus] 53 1e-05 >ONK63994.1 uncharacterized protein A4U43_C07F21020 [Asparagus officinalis] Length = 535 Score = 56.6 bits (135), Expect = 6e-07 Identities = 31/60 (51%), Positives = 46/60 (76%), Gaps = 5/60 (8%) Frame = -3 Query: 167 VLKLEVMAFYLSLLF----FYSAEVLLNVFFIV-LQGLQTCLVALLSRWFKSSGQSFIKV 3 VL + + +F+L LL+ F+ E+L+ +F I ++GLQTCLVALLSRWFK++G+S+IKV Sbjct: 252 VLFVVIASFFLILLYKLMSFWFVELLVVLFCIGGVEGLQTCLVALLSRWFKNAGESYIKV 311 >XP_010255329.1 PREDICTED: signal peptide peptidase-like 4 [Nelumbo nucifera] Length = 538 Score = 53.5 bits (127), Expect = 7e-06 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Frame = -3 Query: 167 VLKLEVMAFYLSLLF----FYSAEVLLNVFFIV-LQGLQTCLVALLSRWFKSSGQSFIKV 3 VL + + + +L LL+ F+ E+L+ +F I ++GLQTCLVALLSRWFK +G+SF+KV Sbjct: 256 VLFVVIASCFLVLLYRLMSFWFVELLVVLFCIGGVEGLQTCLVALLSRWFKHAGESFVKV 315 >OAY81126.1 Signal peptide peptidase-like 5 [Ananas comosus] Length = 520 Score = 53.1 bits (126), Expect = 1e-05 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Frame = -3 Query: 167 VLKLEVMAFYLSLLF----FYSAEVLLNVFFIV-LQGLQTCLVALLSRWFKSSGQSFIKV 3 VL + + +F+L LL+ F+ E+L+ +F I ++GLQTCLVALLSRWF+ + +SF+KV Sbjct: 261 VLFVVIASFFLILLYKLMSFWFVELLVVLFCIGGVEGLQTCLVALLSRWFRRASESFVKV 320 >XP_020112959.1 signal peptide peptidase-like 4 [Ananas comosus] Length = 542 Score = 53.1 bits (126), Expect = 1e-05 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Frame = -3 Query: 167 VLKLEVMAFYLSLLF----FYSAEVLLNVFFIV-LQGLQTCLVALLSRWFKSSGQSFIKV 3 VL + + +F+L LL+ F+ E+L+ +F I ++GLQTCLVALLSRWF+ + +SF+KV Sbjct: 261 VLFVVIASFFLILLYKLMSFWFVELLVVLFCIGGVEGLQTCLVALLSRWFRRASESFVKV 320