BLASTX nr result
ID: Panax25_contig00005649
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00005649 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN05365.1 hypothetical protein DCAR_006202 [Daucus carota subsp... 62 2e-09 KVI08206.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var... 62 2e-09 XP_018822277.1 PREDICTED: 40S ribosomal protein S11-like [Juglan... 62 3e-09 XP_018808968.1 PREDICTED: 40S ribosomal protein S11 [Juglans regia] 62 3e-09 XP_017231777.1 PREDICTED: 40S ribosomal protein S11-like [Daucus... 62 3e-09 XP_017231591.1 PREDICTED: 40S ribosomal protein S11 [Daucus caro... 62 3e-09 XP_017984026.1 PREDICTED: 40S ribosomal protein S11 [Theobroma c... 62 3e-09 OMO50653.1 Ribosomal protein S17 [Corchorus capsularis] 62 3e-09 KJB23701.1 hypothetical protein B456_004G110600 [Gossypium raimo... 61 3e-09 XP_010099867.1 40S ribosomal protein S11 [Morus notabilis] EXB80... 62 5e-09 EOY29410.1 Ribosomal protein S11-beta [Theobroma cacao] 62 5e-09 KHG16468.1 40S ribosomal S11 [Gossypium arboreum] 61 6e-09 XP_017624364.1 PREDICTED: 40S ribosomal protein S11-like [Gossyp... 61 8e-09 XP_017624251.1 PREDICTED: 40S ribosomal protein S11-like [Gossyp... 61 8e-09 XP_016754468.1 PREDICTED: 40S ribosomal protein S11-like [Gossyp... 61 8e-09 XP_016726565.1 PREDICTED: 40S ribosomal protein S11-like [Gossyp... 61 8e-09 XP_012462671.1 PREDICTED: 40S ribosomal protein S11-like [Gossyp... 61 8e-09 XP_012452053.1 PREDICTED: 40S ribosomal protein S11-like [Gossyp... 61 8e-09 XP_012477114.1 PREDICTED: 40S ribosomal protein S11-like [Gossyp... 61 8e-09 XP_012474397.1 PREDICTED: 40S ribosomal protein S11 [Gossypium r... 61 8e-09 >KZN05365.1 hypothetical protein DCAR_006202 [Daucus carota subsp. sativus] Length = 128 Score = 62.4 bits (150), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 99 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 128 >KVI08206.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var. scolymus] Length = 132 Score = 62.4 bits (150), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 103 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 132 >XP_018822277.1 PREDICTED: 40S ribosomal protein S11-like [Juglans regia] Length = 159 Score = 62.4 bits (150), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 159 >XP_018808968.1 PREDICTED: 40S ribosomal protein S11 [Juglans regia] Length = 159 Score = 62.4 bits (150), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 159 >XP_017231777.1 PREDICTED: 40S ribosomal protein S11-like [Daucus carota subsp. sativus] Length = 159 Score = 62.4 bits (150), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 159 >XP_017231591.1 PREDICTED: 40S ribosomal protein S11 [Daucus carota subsp. sativus] KZN10355.1 hypothetical protein DCAR_003011 [Daucus carota subsp. sativus] Length = 159 Score = 62.4 bits (150), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 159 >XP_017984026.1 PREDICTED: 40S ribosomal protein S11 [Theobroma cacao] EOY31291.1 Ribosomal protein S11-beta [Theobroma cacao] OMO52226.1 Ribosomal protein S17 [Corchorus capsularis] Length = 159 Score = 62.4 bits (150), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 159 >OMO50653.1 Ribosomal protein S17 [Corchorus capsularis] Length = 164 Score = 62.4 bits (150), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 135 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 164 >KJB23701.1 hypothetical protein B456_004G110600 [Gossypium raimondii] Length = 116 Score = 61.2 bits (147), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 87 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 116 >XP_010099867.1 40S ribosomal protein S11 [Morus notabilis] EXB80744.1 40S ribosomal protein S11 [Morus notabilis] Length = 184 Score = 62.4 bits (150), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 155 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 184 >EOY29410.1 Ribosomal protein S11-beta [Theobroma cacao] Length = 192 Score = 62.4 bits (150), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI Sbjct: 163 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 192 >KHG16468.1 40S ribosomal S11 [Gossypium arboreum] Length = 141 Score = 61.2 bits (147), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 112 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 141 >XP_017624364.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium arboreum] Length = 159 Score = 61.2 bits (147), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159 >XP_017624251.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium arboreum] Length = 159 Score = 61.2 bits (147), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159 >XP_016754468.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium hirsutum] Length = 159 Score = 61.2 bits (147), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159 >XP_016726565.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium hirsutum] XP_017616818.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium arboreum] Length = 159 Score = 61.2 bits (147), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159 >XP_012462671.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium raimondii] KJB83250.1 hypothetical protein B456_013G237400 [Gossypium raimondii] Length = 159 Score = 61.2 bits (147), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159 >XP_012452053.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium raimondii] KJB64607.1 hypothetical protein B456_010G056800 [Gossypium raimondii] Length = 159 Score = 61.2 bits (147), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159 >XP_012477114.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium raimondii] XP_016692153.1 PREDICTED: 40S ribosomal protein S11-like [Gossypium hirsutum] KJB27059.1 hypothetical protein B456_004G275200 [Gossypium raimondii] Length = 159 Score = 61.2 bits (147), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159 >XP_012474397.1 PREDICTED: 40S ribosomal protein S11 [Gossypium raimondii] KJB23700.1 hypothetical protein B456_004G110600 [Gossypium raimondii] Length = 159 Score = 61.2 bits (147), Expect = 8e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 496 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGI 407 RPLSKTVRFNVLKVIPAGSSGGGKKAFTG+ Sbjct: 130 RPLSKTVRFNVLKVIPAGSSGGGKKAFTGM 159