BLASTX nr result
ID: Panax25_contig00005568
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00005568 (702 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM95939.1 hypothetical protein DCAR_019181 [Daucus carota subsp... 70 4e-10 XP_017252572.1 PREDICTED: two pore calcium channel protein 1A-li... 70 4e-10 KCW47222.1 hypothetical protein EUGRSUZ_K01031 [Eucalyptus grandis] 69 6e-10 XP_010035754.1 PREDICTED: two pore calcium channel protein 1A [E... 69 7e-10 XP_018832075.1 PREDICTED: two pore calcium channel protein 1A-li... 68 2e-09 XP_018832067.1 PREDICTED: two pore calcium channel protein 1A-li... 68 2e-09 XP_018832030.1 PREDICTED: two pore calcium channel protein 1A-li... 68 2e-09 XP_011086365.1 PREDICTED: two pore calcium channel protein 1A [S... 67 4e-09 XP_017258154.1 PREDICTED: two pore calcium channel protein 1A-li... 67 4e-09 XP_010035755.1 PREDICTED: two pore calcium channel protein 1 [Eu... 66 8e-09 XP_006376490.1 calcium channel 1 family protein [Populus trichoc... 65 2e-08 XP_010035756.1 PREDICTED: two pore calcium channel protein 1 [Eu... 65 2e-08 XP_006447307.1 hypothetical protein CICLE_v10014388mg [Citrus cl... 64 5e-08 XP_006447309.1 hypothetical protein CICLE_v10014388mg [Citrus cl... 64 5e-08 XP_006491623.1 PREDICTED: two pore calcium channel protein 1 iso... 64 5e-08 XP_006447308.1 hypothetical protein CICLE_v10014388mg [Citrus cl... 64 5e-08 XP_018838254.1 PREDICTED: two pore calcium channel protein 1B-li... 64 5e-08 XP_007043598.2 PREDICTED: two pore calcium channel protein 1 iso... 64 5e-08 EOX99429.1 Two-pore channel 1 [Theobroma cacao] 64 5e-08 XP_018838246.1 PREDICTED: two pore calcium channel protein 1A-li... 64 5e-08 >KZM95939.1 hypothetical protein DCAR_019181 [Daucus carota subsp. sativus] Length = 704 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = -2 Query: 626 DSEKCAEQDQESGGKD-RRRYVGTKTRSQRVDMLLHHMLSSELD-HTQCS 483 D+EKC ++D E GK+ RRR GTKTRSQRV+MLLHHMLSSELD H QC+ Sbjct: 652 DAEKCRDKDDEGEGKETRRRSAGTKTRSQRVEMLLHHMLSSELDQHAQCA 701 >XP_017252572.1 PREDICTED: two pore calcium channel protein 1A-like [Daucus carota subsp. sativus] Length = 740 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = -2 Query: 626 DSEKCAEQDQESGGKD-RRRYVGTKTRSQRVDMLLHHMLSSELD-HTQCS 483 D+EKC ++D E GK+ RRR GTKTRSQRV+MLLHHMLSSELD H QC+ Sbjct: 688 DAEKCRDKDDEGEGKETRRRSAGTKTRSQRVEMLLHHMLSSELDQHAQCA 737 >KCW47222.1 hypothetical protein EUGRSUZ_K01031 [Eucalyptus grandis] Length = 522 Score = 68.9 bits (167), Expect = 6e-10 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -2 Query: 623 SEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCSTP 477 SE C EQD+E+ G+ R R VGTKTRSQRVD+LLHHMLS+ELD +C++P Sbjct: 473 SENCEEQDKETRGR-RPRLVGTKTRSQRVDVLLHHMLSAELDKAKCTSP 520 >XP_010035754.1 PREDICTED: two pore calcium channel protein 1A [Eucalyptus grandis] KCW47221.1 hypothetical protein EUGRSUZ_K01031 [Eucalyptus grandis] Length = 736 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -2 Query: 623 SEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCSTP 477 SE C EQD+E+ G+ R R VGTKTRSQRVD+LLHHMLS+ELD +C++P Sbjct: 687 SENCEEQDKETRGR-RPRLVGTKTRSQRVDVLLHHMLSAELDKAKCTSP 734 >XP_018832075.1 PREDICTED: two pore calcium channel protein 1A-like isoform X3 [Juglans regia] Length = 682 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -2 Query: 623 SEKCAEQDQE-SGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCSTP 477 SE C EQD+E GGK RRR VGTK++SQRVD LLHHMLS+ELD + S P Sbjct: 633 SENCNEQDKEVDGGKGRRRSVGTKSQSQRVDALLHHMLSAELDRPESSNP 682 >XP_018832067.1 PREDICTED: two pore calcium channel protein 1A-like isoform X2 [Juglans regia] Length = 698 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -2 Query: 623 SEKCAEQDQE-SGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCSTP 477 SE C EQD+E GGK RRR VGTK++SQRVD LLHHMLS+ELD + S P Sbjct: 649 SENCNEQDKEVDGGKGRRRSVGTKSQSQRVDALLHHMLSAELDRPESSNP 698 >XP_018832030.1 PREDICTED: two pore calcium channel protein 1A-like isoform X1 [Juglans regia] XP_018832037.1 PREDICTED: two pore calcium channel protein 1A-like isoform X1 [Juglans regia] XP_018832043.1 PREDICTED: two pore calcium channel protein 1A-like isoform X1 [Juglans regia] XP_018832051.1 PREDICTED: two pore calcium channel protein 1A-like isoform X1 [Juglans regia] XP_018832059.1 PREDICTED: two pore calcium channel protein 1A-like isoform X1 [Juglans regia] Length = 734 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -2 Query: 623 SEKCAEQDQE-SGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCSTP 477 SE C EQD+E GGK RRR VGTK++SQRVD LLHHMLS+ELD + S P Sbjct: 685 SENCNEQDKEVDGGKGRRRSVGTKSQSQRVDALLHHMLSAELDRPESSNP 734 >XP_011086365.1 PREDICTED: two pore calcium channel protein 1A [Sesamum indicum] Length = 739 Score = 66.6 bits (161), Expect = 4e-09 Identities = 31/49 (63%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -2 Query: 623 SEKCAEQD-QESGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCST 480 SEKC + + +E GK+RRR +GTK+R+QRVD+LLHHMLS+EL+ T+CST Sbjct: 690 SEKCEDGEVKEEKGKERRRNIGTKSRNQRVDILLHHMLSAELNKTECST 738 >XP_017258154.1 PREDICTED: two pore calcium channel protein 1A-like [Daucus carota subsp. sativus] KZM91390.1 hypothetical protein DCAR_021245 [Daucus carota subsp. sativus] Length = 751 Score = 66.6 bits (161), Expect = 4e-09 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 626 DSEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDH 495 DSEK D+ESG K+RRR VGTKTRSQRVD+LLHHML ELDH Sbjct: 706 DSEKREGVDKESGKKNRRRNVGTKTRSQRVDILLHHMLGPELDH 749 >XP_010035755.1 PREDICTED: two pore calcium channel protein 1 [Eucalyptus grandis] XP_018720630.1 PREDICTED: two pore calcium channel protein 1 [Eucalyptus grandis] Length = 736 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -2 Query: 623 SEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCSTP 477 SE C EQD+E+ G+ R VGTKTRSQRVD+LLHHMLS+ELD +C+ P Sbjct: 687 SENCEEQDKETRGR-RPHSVGTKTRSQRVDVLLHHMLSAELDKAKCTIP 734 >XP_006376490.1 calcium channel 1 family protein [Populus trichocarpa] ERP54287.1 calcium channel 1 family protein [Populus trichocarpa] Length = 726 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -2 Query: 623 SEKCAEQDQE-SGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCS 483 +EKC +D+E S K RRR VGTKTRSQRVD LLHHMLS+EL+ +CS Sbjct: 677 AEKCEAEDKEGSNSKSRRRSVGTKTRSQRVDNLLHHMLSAELEKPECS 724 >XP_010035756.1 PREDICTED: two pore calcium channel protein 1 [Eucalyptus grandis] XP_010035758.1 PREDICTED: two pore calcium channel protein 1 [Eucalyptus grandis] KCW47218.1 hypothetical protein EUGRSUZ_K01029 [Eucalyptus grandis] KCW47219.1 hypothetical protein EUGRSUZ_K01029 [Eucalyptus grandis] Length = 737 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -2 Query: 623 SEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCSTP 477 SE C QD+E G+ R R VGTKTRSQRVD+LLHHMLS+ELD +C+ P Sbjct: 688 SENCEGQDEEIRGR-RSRSVGTKTRSQRVDVLLHHMLSAELDKAKCTCP 735 >XP_006447307.1 hypothetical protein CICLE_v10014388mg [Citrus clementina] ESR60547.1 hypothetical protein CICLE_v10014388mg [Citrus clementina] Length = 691 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 623 SEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSEL 501 SEKC E+D++ ++RRR VGTKTRSQRVD+LLHHMLS+EL Sbjct: 645 SEKCEEEDKDGEPRERRRRVGTKTRSQRVDVLLHHMLSAEL 685 >XP_006447309.1 hypothetical protein CICLE_v10014388mg [Citrus clementina] ESR60549.1 hypothetical protein CICLE_v10014388mg [Citrus clementina] Length = 697 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 623 SEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSEL 501 SEKC E+D++ ++RRR VGTKTRSQRVD+LLHHMLS+EL Sbjct: 651 SEKCEEEDKDGEPRERRRRVGTKTRSQRVDVLLHHMLSAEL 691 >XP_006491623.1 PREDICTED: two pore calcium channel protein 1 isoform X2 [Citrus sinensis] Length = 714 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 623 SEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSEL 501 SEKC E+D++ ++RRR VGTKTRSQRVD+LLHHMLS+EL Sbjct: 668 SEKCEEEDKDGEPRERRRRVGTKTRSQRVDVLLHHMLSAEL 708 >XP_006447308.1 hypothetical protein CICLE_v10014388mg [Citrus clementina] ESR60548.1 hypothetical protein CICLE_v10014388mg [Citrus clementina] Length = 722 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 623 SEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSEL 501 SEKC E+D++ ++RRR VGTKTRSQRVD+LLHHMLS+EL Sbjct: 676 SEKCEEEDKDGEPRERRRRVGTKTRSQRVDVLLHHMLSAEL 716 >XP_018838254.1 PREDICTED: two pore calcium channel protein 1B-like isoform X2 [Juglans regia] Length = 731 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -2 Query: 626 DSEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCSTP 477 +S + E E G KDRRR VGTK+RSQR+D LLHHMLS+EL+ +Q S P Sbjct: 682 NSGRSEEDKDEDGEKDRRRTVGTKSRSQRIDALLHHMLSAELEQSQSSNP 731 >XP_007043598.2 PREDICTED: two pore calcium channel protein 1 isoform X1 [Theobroma cacao] Length = 737 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -2 Query: 623 SEKCAEQDQESG-GKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCS 483 S C E D+++G GK RRR VGTKTRSQR+D+LLHHMLS+ELD Q S Sbjct: 685 SGNCEEDDKDAGSGKYRRRLVGTKTRSQRIDILLHHMLSAELDKGQSS 732 >EOX99429.1 Two-pore channel 1 [Theobroma cacao] Length = 737 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -2 Query: 623 SEKCAEQDQESG-GKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCS 483 S C E D+++G GK RRR VGTKTRSQR+D+LLHHMLS+ELD Q S Sbjct: 685 SGNCEEDDKDAGSGKYRRRLVGTKTRSQRIDILLHHMLSAELDKGQSS 732 >XP_018838246.1 PREDICTED: two pore calcium channel protein 1A-like isoform X1 [Juglans regia] Length = 738 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -2 Query: 626 DSEKCAEQDQESGGKDRRRYVGTKTRSQRVDMLLHHMLSSELDHTQCSTP 477 +S + E E G KDRRR VGTK+RSQR+D LLHHMLS+EL+ +Q S P Sbjct: 689 NSGRSEEDKDEDGEKDRRRTVGTKSRSQRIDALLHHMLSAELEQSQSSNP 738