BLASTX nr result
ID: Panax25_contig00004439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00004439 (1158 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017188448.1 PREDICTED: geranylgeranyl transferase type-1 subu... 58 9e-06 >XP_017188448.1 PREDICTED: geranylgeranyl transferase type-1 subunit beta-like isoform X1 [Malus domestica] Length = 358 Score = 58.2 bits (139), Expect = 9e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -2 Query: 257 FLFCM*CGITILDVSAAICFMLENWSDMDKEKAKKYIIDCQYY 129 F++C I ++DV AAIC ML NWS MDKEKAK+YI++CQ Y Sbjct: 161 FIYCA-ASIXLIDVPAAICHMLGNWSGMDKEKAKEYILNCQSY 202